Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20570 209 / 1e-71 HRT1, ROC1, RBX1, ATRBX1 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) AT3G42830 181 / 2e-60 RING/U-box superfamily protein (.1) AT3G05870 68 / 5e-16 APC11 anaphase-promoting complex/cyclosome 11 (.1.2) AT3G47180 41 / 4e-05 RING/U-box superfamily protein (.1) AT4G12140 40 / 8e-05 RING/U-box superfamily protein (.1) AT3G63530 40 / 0.0001 BB2, BB BIG BROTHER, RING/U-box superfamily protein (.1.2) AT5G40250 39 / 0.0002 RING/U-box superfamily protein (.1) AT3G16090 39 / 0.0002 AtHrd1A homolog of yeast Hrd1, RING/U-box superfamily protein (.1) AT1G65040 39 / 0.0003 AtHrd1B homolog of yeast Hrd1, RING/U-box superfamily protein (.1.2.3) AT3G48030 39 / 0.0003 hypoxia-responsive family protein / zinc finger (C3HC4-type RING finger) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G067100 [exp] 207 / 5e-71 AT5G20570 206 / 2e-70 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Potri.001G167400 [exp] 205 / 4e-70 AT5G20570 203 / 3e-69 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Potri.017G037701 [exp] 47 / 2e-08 AT3G05870 123 / 5e-39 anaphase-promoting complex/cyclosome 11 (.1.2) Potri.001G322600 [exp] 43 / 1e-05 AT5G08139 71 / 5e-14 RING/U-box superfamily protein (.1) Potri.002G140600 [exp] 42 / 3e-05 AT3G60220 194 / 3e-59 TOXICOS EN LEVADURA 4 (.1) Potri.011G097100 [exp] 40 / 9e-05 AT1G53190 372 / 2e-123 RING/U-box superfamily protein (.1.2) Potri.001G373700 [exp] 39 / 0.0004 AT1G53190 354 / 1e-116 RING/U-box superfamily protein (.1.2) Potri.006G239500 [exp] 39 / 0.0004 AT2G20030 248 / 1e-78 RING/U-box superfamily protein (.1) Potri.013G088400 [exp] 38 / 0.0006 AT3G16090 613 / 0.0 homolog of yeast Hrd1, RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015667 [exp] 207 / 7e-71 AT5G20570 200 / 5e-68 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Lus10013153 [exp] 204 / 1e-69 AT5G20570 206 / 2e-70 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Lus10037680 [exp] 129 / 3e-40 AT5G20570 122 / 9e-38 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Lus10008115 [exp] 129 / 5e-40 AT5G20570 129 / 2e-40 REGULATOR OF CULLINS-1, RING-box 1 (.1.2.3) Lus10015126 [exp] 68 / 2e-15 AT3G05870 156 / 2e-50 anaphase-promoting complex/cyclosome 11 (.1.2) Lus10031549 [exp] 66 / 4e-14 AT3G05870 158 / 6e-50 anaphase-promoting complex/cyclosome 11 (.1.2) Lus10040359 [exp] 39 / 0.0005 AT3G16090 652 / 0.0 homolog of yeast Hrd1, RING/U-box superfamily protein (.1) Lus10023477 [exp] 39 / 0.0005 AT3G16090 650 / 0.0 homolog of yeast Hrd1, RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF12861 [poplar] [flax] zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger
Representative CDS sequence Show only first row Show all	>Potri.006G141300.1 pacid=42768680 polypeptide=Potri.006G141300.1.p locus=Potri.006G141300 ID=Potri.006G141300.1.v4.1 annot-version=v4.1 ATGTCAACTTTGGACTCGGAGGTAACCCTGGTTCCAGTAGGCGAGACGTCAGGCACTGCTGGTCCTTCTTCCTCTAAGAAACCAAAGCGTTTCGAGATCA AAAAGTGGAACGCCGTCTCTCTCTGGGCTTGGGATATTGTTGTTGATAACTGTGCGATTTGCAGAAACCATATCATGGATCTATGTATTGAATGCCAAGC AAACCAGGCTAGCGCTACTAGTGAGGAATGCACTGTTGCTTGGGGGGTGTGTAACCATGCATTTCACTTTCACTGCATCAGCCGATGGCTCAAGACTCGT CAAGTGTGCCCATTGGATAATAGTGAGTGGGAGTTTCAGAAGTATGGCCACTAG
AA sequence Show only first row Show all	>Potri.006G141300.1 pacid=42768680 polypeptide=Potri.006G141300.1.p locus=Potri.006G141300 ID=Potri.006G141300.1.v4.1 annot-version=v4.1 MSTLDSEVTLVPVGETSGTAGPSSSKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTR QVCPLDNSEWEFQKYGH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G20570		HRT1, ROC1, RBX...	REGULATOR OF CULLINS-1, RING-b...		Potri.006G141300 [exp]	0	1
AT3G22110		PAC1	20S proteasome alpha subunit C...		Potri.006G008800 [exp]	3.46	0.8683	Pt-PAC1.1
AT5G23540			Mov34/MPN/PAD-1 family protein...		Potri.002G127900 [exp]	5.19	0.8626
AT3G60820		PBF1	N-terminal nucleophile aminohy...		Potri.014G069800 [exp]	6.48	0.8688	PBF1.2
AT2G27020		PAG1	20S proteasome alpha subunit G...		Potri.001G224100 [exp]	7.93	0.8380	Pt-PAG1.1
AT3G05530		ATS6A.2, RPT5A	regulatory particle triple-A A...		Potri.005G025100 [exp]	8.83	0.7947	Pt-RPT5.1
AT1G02280		PPI1, ATTOC33, ...	PLASTID PROTEIN IMPORT 1, tran...		Potri.014G109400 [exp]	9.74	0.8121
AT2G18040		PIN1AT	"peptidylprolyl cis/trans isom...		Potri.007G013400 [exp]	13.63	0.8429
AT1G20200		HAP15, EMB2719	HAPLESS 15, EMBRYO DEFECTIVE 2...		Potri.009G136900 [exp]	14.49	0.8192
AT5G05780		RPN8A, AE3, ATH...	ASYMMETRIC LEAVES ENHANCER 3, ...		Potri.010G192200 [exp]	14.69	0.8343	Pt-RPN8.1
AT4G38630		ATMCB1, MBP1, A...	MULTIUBIQUITIN-CHAIN-BINDING P...		Potri.009G133000 [exp]	14.83	0.7912

Compare expression of checked genes

Potri.006G141300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.