Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17455 166 / 9e-55 ELF4-L4 ELF4-like 4 (.1.2) AT2G06255 162 / 3e-53 ELF4-L3 ELF4-like 3 (.1) AT1G72630 161 / 1e-52 ELF4-L2 ELF4-like 2 (.1) AT2G40080 83 / 1e-21 ELF4 EARLY FLOWERING 4, Protein of unknown function (DUF1313) (.1) AT2G29950 79 / 3e-20 ELF4-L1 ELF4-like 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G170100 [exp] 186 / 2e-62 AT1G17455 158 / 1e-51 ELF4-like 4 (.1.2) Potri.003G063900 [exp] 185 / 4e-62 AT1G17455 156 / 7e-51 ELF4-like 4 (.1.2) Potri.019G131700 [exp] 119 / 7e-36 AT2G06255 107 / 2e-31 ELF4-like 3 (.1) Potri.008G068200 [exp] 87 / 2e-23 AT2G40080 112 / 2e-33 EARLY FLOWERING 4, Protein of unknown function (DUF1313) (.1) Potri.001G251600 [exp] 83 / 1e-21 AT2G29950 109 / 6e-32 ELF4-like 1 (.1) Potri.009G046400 [exp] 78 / 8e-20 AT2G29950 99 / 6e-28 ELF4-like 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000408 [exp] 173 / 2e-57 AT1G17455 148 / 1e-47 ELF4-like 4 (.1.2) Lus10001250 [exp] 172 / 4e-57 AT1G17455 148 / 1e-47 ELF4-like 4 (.1.2) Lus10000371 [exp] 165 / 6e-54 AT1G17455 140 / 2e-44 ELF4-like 4 (.1.2) Lus10018237 [exp] 82 / 5e-21 AT2G29950 112 / 6e-33 ELF4-like 1 (.1) Lus10040667 [exp] 80 / 2e-20 AT2G29950 108 / 4e-31 ELF4-like 1 (.1) Lus10028288 [exp] 66 / 5e-15 AT2G40080 110 / 1e-32 EARLY FLOWERING 4, Protein of unknown function (DUF1313) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07011 [poplar] [flax] Elf4 Early Flowering 4 domain
Representative CDS sequence Show only first row Show all	>Potri.006G143800.3 pacid=42770567 polypeptide=Potri.006G143800.3.p locus=Potri.006G143800 ID=Potri.006G143800.3.v4.1 annot-version=v4.1 ATGGAGGGTGACACATTCTCAGGACTTGGCAATGGTACCCAGATAGATGGCAAGATCTTGCAGACATTTCAAAAGAACTTTGTTCAGGTCCAAAATATCT TGGATCAGAATAGGCTTCTCATTAATGAGATAAATCAGAACCATGAATCCAAGATCCCTGACAACCTGAGCAGAAATGTGGGTTTGATAAGGGAGCTCAA CAACAATATCAGGAGGGTAGTTGACCTTTATGCTGATCTTTCTACCTCCTTCACCAAATCCATGGACGCCTCTTCTGAGGGGGATTCTAGTGGTGCCTTG AAATCTGATGGCAAAGGTGGCCACAAGAGAAATAGACCTGCATAG
AA sequence Show only first row Show all	>Potri.006G143800.3 pacid=42770567 polypeptide=Potri.006G143800.3.p locus=Potri.006G143800 ID=Potri.006G143800.3.v4.1 annot-version=v4.1 MEGDTFSGLGNGTQIDGKILQTFQKNFVQVQNILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNNIRRVVDLYADLSTSFTKSMDASSEGDSSGAL KSDGKGGHKRNRPA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17455		ELF4-L4	ELF4-like 4 (.1.2)		Potri.006G143800 [exp]	0	1
AT1G62400		HT1	high leaf temperature 1, Prote...		Potri.012G080000 [exp]	5.56	0.7842
AT2G26510		PDE135	pigment defective embryo 135, ...		Potri.014G035800 [exp]	5.65	0.7390	PDE135.1
AT1G63840			RING/U-box superfamily protein...		Potri.003G130900 [exp]	7.48	0.6998
AT2G44745	WRKY	WRKY12	WRKY family transcription fact...		Potri.014G050000 [exp]	12.48	0.7305
AT4G35740		ATRECQ3, RECQL3	A. THALIANA RECQ HELICASE 3, D...		Potri.005G107400 [exp]	21.84	0.6743
AT2G23810		TET8	tetraspanin8 (.1)		Potri.006G177900 [exp]	22.18	0.6790
AT3G22780	CPP	ATTSO1, TSO1	CHINESE FOR 'UGLY', Tesmin/TSO...		Potri.013G038301 [exp]	25.09	0.6542
AT2G32800		AP4.3A	protein kinase family protein ...		Potri.017G055000 [exp]	26.26	0.6822
AT4G14746			unknown protein		Potri.008G156800 [exp]	30.98	0.6396
AT3G04910		ATWNK1, ZIK4, W...	with no lysine (K) kinase 1 (....		Potri.013G036300 [exp]	32.75	0.6249

Compare expression of checked genes

Potri.006G143800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.