Potri.006G144200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G17600 90 / 1e-21 RING/U-box superfamily protein (.1)
AT1G04360 88 / 9e-21 RING/U-box superfamily protein (.1)
AT4G17905 83 / 4e-19 ATL4H RING/U-box superfamily protein (.1)
AT5G05810 82 / 1e-18 ATL43 RING/U-box superfamily protein (.1)
AT3G16720 81 / 2e-18 ATL2 TOXICOS EN LEVADURA 2 (.1)
AT3G03550 81 / 3e-18 RING/U-box superfamily protein (.1)
AT5G10380 79 / 1e-17 ATRING1, RING1 RING/U-box superfamily protein (.1)
AT2G17450 77 / 1e-17 RHA3A RING-H2 finger A3A (.1)
AT1G72310 79 / 2e-17 ATL3 RING/U-box superfamily protein (.1)
AT4G15975 77 / 2e-17 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G206200 106 / 4e-29 AT5G17600 91 / 6e-22 RING/U-box superfamily protein (.1)
Potri.008G054200 104 / 1e-28 AT1G20823 80 / 6e-19 RING/U-box superfamily protein (.1)
Potri.013G073500 94 / 7e-23 AT3G03550 262 / 2e-85 RING/U-box superfamily protein (.1)
Potri.018G042501 89 / 4e-21 AT2G20030 244 / 2e-77 RING/U-box superfamily protein (.1)
Potri.001G141200 89 / 6e-21 AT5G17600 207 / 1e-63 RING/U-box superfamily protein (.1)
Potri.019G043900 87 / 9e-21 AT3G03550 223 / 3e-71 RING/U-box superfamily protein (.1)
Potri.003G093100 87 / 2e-20 AT5G17600 196 / 1e-59 RING/U-box superfamily protein (.1)
Potri.003G184800 84 / 3e-20 AT2G37580 120 / 6e-34 RING/U-box superfamily protein (.1)
Potri.008G219200 85 / 6e-20 AT3G16720 197 / 2e-61 TOXICOS EN LEVADURA 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005954 111 / 3e-29 AT3G04020 111 / 7e-28 unknown protein
Lus10029456 90 / 2e-23 AT5G10380 86 / 3e-21 RING/U-box superfamily protein (.1)
Lus10013618 93 / 9e-23 AT5G17600 220 / 1e-69 RING/U-box superfamily protein (.1)
Lus10027736 83 / 3e-20 AT4G17905 89 / 8e-22 RING/U-box superfamily protein (.1)
Lus10037490 86 / 9e-20 AT3G16720 224 / 2e-70 TOXICOS EN LEVADURA 2 (.1)
Lus10006493 85 / 9e-20 AT3G16720 221 / 5e-71 TOXICOS EN LEVADURA 2 (.1)
Lus10012975 85 / 2e-19 AT2G20030 291 / 2e-95 RING/U-box superfamily protein (.1)
Lus10034953 84 / 5e-19 AT2G20030 278 / 2e-90 RING/U-box superfamily protein (.1)
Lus10000885 78 / 6e-19 AT2G20030 79 / 1e-18 RING/U-box superfamily protein (.1)
Lus10012745 82 / 2e-18 AT4G33565 168 / 4e-49 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.006G144200.1 pacid=42767723 polypeptide=Potri.006G144200.1.p locus=Potri.006G144200 ID=Potri.006G144200.1.v4.1 annot-version=v4.1
ATGGTAGATAATATTACAAGCCCTTTATTTGAGTCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCACACAAATCCAATCTGCCAATGTTATATTATGGCC
TAGTAGTTGTTGGCACAGCTGCTATAGTGCTAGCTGTTTACAACCTTATAATCATCAAGTGGTGCGCTCAACGTGGAGGCCGATCAGGGCAGGGACCAAA
TGTGTTTACAGAGGTAACAGCAAGCCAGAGTTTTGAACACTCCAACAGCAACTTGCCGTCTAGTTTCAAGTACAAAAAGGGAAAAATAGACGGTGACCAA
GACCAGGGAAGTGGCTATGAATGTGCTGTTTGCTTATCGGCTTTTGAAGAGGGAGAAGAGGTTAGGCAATTGCCAAGGTGTAAGCACTCATTTCATGCTC
CTTGTATAGATATGTGGCTATATTCCCACTCTGATTGCCCGCTTTGTCGTTCAAGTGTTGATCCTCCTCTTGCGGTGTGTAATAGAAGAACGGCCGCGGC
GGCAGCCGATACATCGGAGAATTCTAGAGAAGGGTTACTGGATTCAGCCATCAATAATACTGTATGA
AA sequence
>Potri.006G144200.1 pacid=42767723 polypeptide=Potri.006G144200.1.p locus=Potri.006G144200 ID=Potri.006G144200.1.v4.1 annot-version=v4.1
MVDNITSPLFESPPPPPPPPPPHKSNLPMLYYGLVVVGTAAIVLAVYNLIIIKWCAQRGGRSGQGPNVFTEVTASQSFEHSNSNLPSSFKYKKGKIDGDQ
DQGSGYECAVCLSAFEEGEEVRQLPRCKHSFHAPCIDMWLYSHSDCPLCRSSVDPPLAVCNRRTAAAAADTSENSREGLLDSAINNTV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G17600 RING/U-box superfamily protein... Potri.006G144200 0 1
AT2G35790 unknown protein Potri.008G042800 3.00 0.8702
AT2G24270 ALDH11A3 aldehyde dehydrogenase 11A3 (.... Potri.018G020600 6.70 0.8196
AT2G31130 unknown protein Potri.004G055300 7.34 0.8423
AT3G52850 VSR1;1, GFS1, B... VACUOLAR SORTING RECEPTOR 1;1,... Potri.016G137350 7.74 0.8317
AT1G02260 Divalent ion symporter (.1) Potri.015G146900 9.16 0.7824
AT4G21740 unknown protein Potri.001G371800 10.58 0.8206
AT2G23060 Acyl-CoA N-acyltransferases (N... Potri.007G054200 12.40 0.8047 Pt-HLS1.2
AT2G30590 WRKY WRKY21 WRKY DNA-binding protein 21 (.... Potri.003G111900 15.00 0.8382
AT3G62240 C2H2ZnF RING/U-box superfamily protein... Potri.005G004600 18.16 0.8182
AT3G52850 VSR1;1, GFS1, B... VACUOLAR SORTING RECEPTOR 1;1,... Potri.016G137300 18.89 0.8023

Potri.006G144200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.