Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G06530 62 / 5e-13 VPS2.1 SNF7 family protein (.1) AT1G03950 48 / 6e-08 VPS2.3 vacuolar protein sorting-associated protein 2.3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G170400 [exp] 73 / 5e-17 AT2G06530 326 / 2e-114 SNF7 family protein (.1) Potri.018G065100 [exp] 70 / 5e-16 AT2G06530 332 / 9e-117 SNF7 family protein (.1) Potri.005G227000 [exp] 47 / 2e-07 AT1G03950 309 / 3e-108 vacuolar protein sorting-associated protein 2.3 (.1) Potri.002G035900 [exp] 46 / 4e-07 AT1G03950 308 / 8e-108 vacuolar protein sorting-associated protein 2.3 (.1) Potri.011G154700 [exp] 40 / 8e-05 AT5G44560 331 / 1e-116 SNF7 family protein (.1.2) Potri.001G442500 [exp] 39 / 9e-05 AT5G44560 328 / 3e-115 SNF7 family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021561 [exp] 67 / 2e-15 AT2G06530 194 / 1e-63 SNF7 family protein (.1) Lus10017166 [exp] 67 / 1e-14 AT2G06530 357 / 2e-126 SNF7 family protein (.1) Lus10037660 [exp] 57 / 4e-11 AT2G06530 358 / 6e-127 SNF7 family protein (.1) Lus10015642 [exp] 49 / 4e-08 AT2G06530 338 / 1e-118 SNF7 family protein (.1) Lus10023396 [exp] 38 / 0.0005 AT5G44560 270 / 2e-91 SNF7 family protein (.1.2) Lus10038407 [exp] 37 / 0.0006 AT5G44560 323 / 5e-113 SNF7 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0235 [poplar] [flax] PspA PF03357 [poplar] [flax] Snf7 Snf7
Representative CDS sequence Show only first row Show all	>Potri.006G144300.2 pacid=42769169 polypeptide=Potri.006G144300.2.p locus=Potri.006G144300 ID=Potri.006G144300.2.v4.1 annot-version=v4.1 ATGCAAAAATTTGAGAGGCAGAACGAAAAGATGGAAATGGTGACAGAGGTGATGGGAGATGCCATTGATGACGCTTTGGAAGGGGATGAGGAAGAAGAGG AAACTGAAGAACAAGTGAACCAAGTCCTTGATGAGATTGGAATTGAACTTGTAAATGCACCATCATCTGCTGTTGCTGCACCAGCTGCGAAGGGTAAGGT TGCACAAGTGGAAACAACAGGGGACGAAGACAGTGGAACTGACAGTGACTTGCAGGCAAGGTTAGACAATTTGAGAAGAATGTGA
AA sequence Show only first row Show all	>Potri.006G144300.2 pacid=42769169 polypeptide=Potri.006G144300.2.p locus=Potri.006G144300 ID=Potri.006G144300.2.v4.1 annot-version=v4.1 MQKFERQNEKMEMVTEVMGDAIDDALEGDEEEEETEEQVNQVLDEIGIELVNAPSSAVAAPAAKGKVAQVETTGDEDSGTDSDLQARLDNLRRM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G06530		VPS2.1	SNF7 family protein (.1)		Potri.006G144300 [exp]	0	1
					Potri.001G383801 [exp]	7.74	0.7291
AT4G02570		AXR6, ATCUL1	AUXIN RESISTANT 6, cullin 1 (....		Potri.013G020000 [exp]	11.00	0.7398
					Potri.008G206100 [exp]	13.56	0.7737
AT3G43610			Spc97 / Spc98 family of spindl...		Potri.001G184450 [exp]	13.85	0.6858
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Potri.001G437700 [exp]	17.60	0.7455
					Potri.013G104601 [exp]	19.36	0.6858
					Potri.001G388701 [exp]	24.24	0.6892
					Potri.002G047750 [exp]	24.65	0.7554
AT3G02280			Flavodoxin family protein (.1)		Potri.011G027100 [exp]	39.49	0.6765
					Potri.001G382300 [exp]	48.37	0.6902

Compare expression of checked genes

Potri.006G144300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.