Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G26060 152 / 3e-48 Ribosomal protein L18ae family (.1) AT5G57060 142 / 1e-44 unknown protein AT1G54217 97 / 5e-27 Ribosomal protein L18ae family (.1.2.3) AT3G14595 43 / 9e-06 Ribosomal protein L18ae family (.1) AT1G53560 43 / 1e-05 Ribosomal protein L18ae family (.1) AT1G29970 41 / 5e-05 RPL18AA 60S ribosomal protein L18A-1 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G050900 [exp] 233 / 2e-80 AT4G26060 151 / 4e-48 Ribosomal protein L18ae family (.1) Potri.001G198700 [exp] 113 / 1e-33 AT4G26060 107 / 3e-31 Ribosomal protein L18ae family (.1) Potri.003G044400 [exp] 102 / 2e-29 AT5G57060 103 / 3e-30 unknown protein Potri.001G380200 [exp] 44 / 3e-06 AT1G17080 127 / 3e-38 Ribosomal protein L18ae family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011943 [exp] 171 / 3e-55 AT4G26060 150 / 4e-47 Ribosomal protein L18ae family (.1) Lus10027625 [exp] 169 / 6e-55 AT4G26060 147 / 2e-46 Ribosomal protein L18ae family (.1) Lus10026180 [exp] 49 / 2e-07 AT1G29970 63 / 7e-12 60S ribosomal protein L18A-1 (.1.2.3) Lus10042485 [exp] 45 / 1e-06 AT3G17940 113 / 2e-31 Galactose mutarotase-like superfamily protein (.1) Lus10026193 [exp] 40 / 0.0001 AT1G17080 87 / 3e-22 Ribosomal protein L18ae family (.1) Lus10042474 [exp] 39 / 0.0008 AT1G53560 85 / 1e-20 Ribosomal protein L18ae family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G146300.2 pacid=42768870 polypeptide=Potri.006G146300.2.p locus=Potri.006G146300 ID=Potri.006G146300.2.v4.1 annot-version=v4.1 ATGGATCCAAATGCTGCCATTGAGGAGAGAAAGGGTTTCAGGAATGGCGTTGAGTTAGTGAAATCTGTCTCTGATAAGCACATTGATCTCCTCAGGCCAT CTGCTCGATACTATACAGCATCAAAGGGGCAAGCAACAGATGCTGCAGATGGAGAAAAAGGAAAGTATACTCTTATTAGAGATCCTGAGGATTTTCAAGG GATTTATGACAAGCCCCTTCCATGCTTTGGCTGTGGGGTAGGATGGTTTTCTTTTCTTTTGGGATTTGTGTTCCCATTGATGTGGTATTATGGTACATTT CTTTACTTTGGAAATTACCATCGAAGGGATCCAAGGGAGCGTGCAGGCCTTGCTGCTGCTGCAATTGCTGCAATGGTGTTTTCTGTCGTGTTGATGGTCA TAGCAGCTTATTTTTCTCTATTTTAG
AA sequence Show only first row Show all	>Potri.006G146300.2 pacid=42768870 polypeptide=Potri.006G146300.2.p locus=Potri.006G146300 ID=Potri.006G146300.2.v4.1 annot-version=v4.1 MDPNAAIEERKGFRNGVELVKSVSDKHIDLLRPSARYYTASKGQATDAADGEKGKYTLIRDPEDFQGIYDKPLPCFGCGVGWFSFLLGFVFPLMWYYGTF LYFGNYHRRDPRERAGLAAAAIAAMVFSVVLMVIAAYFSLF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G26060			Ribosomal protein L18ae family...		Potri.006G146300 [exp]	0	1
AT4G16520		ATG8F	autophagy 8f, Ubiquitin-like s...		Potri.014G060300 [exp]	1.41	0.8036
AT1G54210		ATATG12, APG12,...	AUTOPHAGY 12 A, AUTOPHAGY 12, ...		Potri.001G169700 [exp]	2.00	0.7841
AT5G46020			unknown protein		Potri.011G060800 [exp]	4.89	0.7810
AT2G16710			Iron-sulphur cluster biosynthe...		Potri.008G020400 [exp]	6.00	0.7204
AT5G40650		SDH2-2	succinate dehydrogenase 2-2 (....		Potri.001G338400 [exp]	6.92	0.7524	SDH2.1
AT2G24860			DnaJ/Hsp40 cysteine-rich domai...		Potri.006G266800 [exp]	9.89	0.7452
AT3G10640		VPS60.1	SNF7 family protein (.1.2)		Potri.008G018300 [exp]	10.39	0.7074
AT4G29160		SNF7.1	SNF7 family protein (.1.2.3)		Potri.018G069900 [exp]	11.66	0.7211
AT5G40370		GRXC2	glutaredoxin C2, Glutaredoxin ...		Potri.001G347700 [exp]	16.58	0.7074	PtrcGrx_C2
AT5G40670			PQ-loop repeat family protein ...		Potri.017G070300 [exp]	17.02	0.6812

Compare expression of checked genes

Potri.006G146300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.