Potri.006G146800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G29735 72 / 3e-18 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G215200 99 / 3e-29 AT4G29735 81 / 7e-22 unknown protein
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05251 Ost5 Oligosaccharyltransferase subunit 5
Representative CDS sequence
>Potri.006G146800.2 pacid=42767712 polypeptide=Potri.006G146800.2.p locus=Potri.006G146800 ID=Potri.006G146800.2.v4.1 annot-version=v4.1
ATGGGTTCGAAGGCAGCAGCAATAACGAGTCCAGTCCCGGTGACATGGTACCCAACCCTAGCAATCTTCATGCTGGCCATCGGCCTTATGGTCTCTGCTT
CATTCTTCATCTACGAAGCGACCTCTTCTAGGAGAAGCCGCAGTTTGGCCAAGGAGCTTACTACAGGAGCATTGGCCTCTTTCTTTCTGGGTTTTGGGTC
CTTGTTCATGCTACTTGCTTCTGGTGTTTATGTCTGA
AA sequence
>Potri.006G146800.2 pacid=42767712 polypeptide=Potri.006G146800.2.p locus=Potri.006G146800 ID=Potri.006G146800.2.v4.1 annot-version=v4.1
MGSKAAAITSPVPVTWYPTLAIFMLAIGLMVSASFFIYEATSSRRSRSLAKELTTGALASFFLGFGSLFMLLASGVYV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G29735 unknown protein Potri.006G146800 0 1
AT3G05100 S-adenosyl-L-methionine-depend... Potri.013G034000 2.00 0.8736
AT4G30010 unknown protein Potri.006G075600 2.23 0.8838
AT1G80500 SNARE-like superfamily protein... Potri.003G183400 2.44 0.8735
AT4G00170 Plant VAMP (vesicle-associated... Potri.002G144800 3.31 0.8115
AT4G38800 ATMTN1, ATMTAN1 ARABIDOPSIS METHYLTHIOADENOSIN... Potri.004G167200 3.74 0.8026
AT1G77710 unknown protein Potri.002G087200 4.89 0.8401
AT5G47890 NADH-ubiquinone oxidoreductase... Potri.003G159100 8.48 0.8140
AT2G30410 TFCA, KIS TUBULIN FOLDING FACTOR A, tubu... Potri.013G071100 8.66 0.7983 TFCFA,Pt-KIS.1
AT1G52740 HTA9 histone H2A protein 9 (.1) Potri.006G249400 8.94 0.8345 HTA906
AT5G64140 RPS28 ribosomal protein S28 (.1) Potri.010G245400 9.48 0.8216 Pt-RPS28.1

Potri.006G146800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.