Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G19790 287 / 9e-102 SNARE-like superfamily protein (.1) AT1G47830 130 / 2e-39 SNARE-like superfamily protein (.1) AT2G17380 127 / 3e-38 AP19 associated protein 19 (.1) AT4G35410 127 / 4e-38 Clathrin adaptor complex small chain family protein (.1.2) AT3G50860 112 / 3e-32 Clathrin adaptor complex small chain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G238701 [exp] 128 / 1e-38 AT1G47830 275 / 8e-97 SNARE-like superfamily protein (.1) Potri.002G022900 [exp] 127 / 2e-38 AT1G47830 278 / 6e-98 SNARE-like superfamily protein (.1) Potri.012G052000 [exp] 127 / 4e-38 AT2G17380 307 / 6e-109 associated protein 19 (.1) Potri.014G079000 [exp] 125 / 2e-37 AT4G35410 291 / 1e-102 Clathrin adaptor complex small chain family protein (.1.2) Potri.002G001800 [exp] 120 / 2e-35 AT2G17380 278 / 3e-97 associated protein 19 (.1) Potri.007G025400 [exp] 106 / 5e-30 AT3G50860 296 / 1e-104 Clathrin adaptor complex small chain family protein (.1) Potri.005G122900 [exp] 103 / 9e-29 AT3G50860 286 / 1e-100 Clathrin adaptor complex small chain family protein (.1) Potri.003G043200 [exp] 40 / 0.0001 AT1G60970 288 / 4e-101 SNARE-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012924 [exp] 286 / 3e-101 AT2G19790 280 / 6e-99 SNARE-like superfamily protein (.1) Lus10035004 [exp] 268 / 3e-94 AT2G19790 262 / 6e-92 SNARE-like superfamily protein (.1) Lus10024337 [exp] 127 / 3e-37 AT1G47830 274 / 5e-95 SNARE-like superfamily protein (.1) Lus10026316 [exp] 124 / 7e-37 AT2G17380 297 / 7e-105 associated protein 19 (.1) Lus10042352 [exp] 122 / 1e-35 AT2G17380 297 / 3e-104 associated protein 19 (.1) Lus10003641 [exp] 108 / 8e-31 AT4G35410 251 / 8e-87 Clathrin adaptor complex small chain family protein (.1.2) Lus10041742 [exp] 90 / 4e-23 AT3G50860 278 / 6e-97 Clathrin adaptor complex small chain family protein (.1) Lus10024011 [exp] 87 / 5e-22 AT3G50860 215 / 3e-72 Clathrin adaptor complex small chain family protein (.1) Lus10037624 [exp] 43 / 2e-05 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1) Lus10006883 [exp] 43 / 2e-05 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0431 [poplar] [flax] PF PF01217 [poplar] [flax] Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence Show only first row Show all	>Potri.006G149100.5 pacid=42769599 polypeptide=Potri.006G149100.5.p locus=Potri.006G149100 ID=Potri.006G149100.5.v4.1 annot-version=v4.1 ATGGGGATAAGATTCATATTAATGGTGAACAAGCAAGGACAAACTCGTTTAGCCCAATACTATGAATGGCTCACCCTCGAAGAACGCCGTGCCCTTGAAG GAGAAATTGTTCGCAAATGCCTTGCTCGCAACGACCAACAGTGTTCCTTTGTAGAGCATCGCAACTACAAAATTATATACCGACGCTACGCATCATTGTT TTTCTTGGTTGGAGTTGACAATGATGAAAATGAGCTTGCGATTTTGGAATTCATACATCTTTTAGTTGAAACCATGGACCGTCATTTTGGCAATGTGTGT GAGCTAGACATCATGTTCCATTTAGAAAAAGCTCATTTCATGCTGGAAGAGATGGTCATGAATGGTTGCATTGTTGAGACAAGCAAGTCTAACATTCTGA GCCCAATACAACTGATGGACAAAACATCATAA
AA sequence Show only first row Show all	>Potri.006G149100.5 pacid=42769599 polypeptide=Potri.006G149100.5.p locus=Potri.006G149100 ID=Potri.006G149100.5.v4.1 annot-version=v4.1 MGIRFILMVNKQGQTRLAQYYEWLTLEERRALEGEIVRKCLARNDQQCSFVEHRNYKIIYRRYASLFFLVGVDNDENELAILEFIHLLVETMDRHFGNVC ELDIMFHLEKAHFMLEEMVMNGCIVETSKSNILSPIQLMDKTS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G19790			SNARE-like superfamily protein...		Potri.006G149100 [exp]	0	1
AT2G23940			Protein of unknown function (D...		Potri.018G101100 [exp]	1.73	0.9101
AT2G21870		MGP1	MALE GAMETOPHYTE DEFECTIVE 1, ...		Potri.005G085500 [exp]	7.34	0.9122
AT2G45200		ATGOS12, GOS12	golgi snare 12 (.1.2)		Potri.014G066800 [exp]	10.58	0.9071	GOS12.1
AT1G20760			Calcium-binding EF hand family...		Potri.002G008300 [exp]	12.96	0.8997
AT1G49140			Complex I subunit NDUFS6 (.1)		Potri.012G056900 [exp]	15.42	0.8964
AT1G02130		ARA5, AtRABD2a,...	ARABIDOPSIS THALIANA RAB D2A, ...		Potri.014G049400 [exp]	16.43	0.9011	RAB1.2
AT5G59910		HTB4	Histone superfamily protein (....		Potri.008G030500 [exp]	20.97	0.8836
AT2G17380		AP19	associated protein 19 (.1)		Potri.012G052000 [exp]	21.02	0.8786	AP19.2
AT1G15370			SNARE-like superfamily protein...		Potri.001G193100 [exp]	24.18	0.8856
AT3G12587			Oligosaccaryltransferase (.1)		Potri.010G207100 [exp]	28.37	0.8807

Compare expression of checked genes

Potri.006G149100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.