Potri.006G159300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G24577 43 / 6e-07 unknown protein
AT1G67910 43 / 9e-07 unknown protein
AT3G13227 42 / 2e-06 serine-rich protein-related (.1)
AT5G55980 41 / 6e-06 serine-rich protein-related (.1)
AT1G52342 40 / 8e-06 unknown protein
AT5G20370 42 / 1e-05 serine-rich protein-related (.1)
AT3G56500 39 / 3e-05 serine-rich protein-related (.1)
AT5G25280 37 / 0.0006 serine-rich protein-related (.1.2)
AT5G11090 36 / 0.001 serine-rich protein-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G078900 132 / 3e-42 AT3G13227 42 / 3e-06 serine-rich protein-related (.1)
Potri.010G046700 42 / 2e-06 AT1G67910 82 / 4e-22 unknown protein
Potri.008G186200 40 / 2e-05 AT1G67910 85 / 4e-23 unknown protein
Potri.001G371400 39 / 7e-05 AT5G55980 50 / 2e-08 serine-rich protein-related (.1)
Potri.018G079200 38 / 0.0001 AT1G67910 45 / 9e-08 unknown protein
Potri.006G060700 38 / 0.0001 AT5G11090 66 / 4e-14 serine-rich protein-related (.1)
Potri.018G120300 37 / 0.0003 AT5G11090 67 / 1e-14 serine-rich protein-related (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023630 61 / 7e-14 AT1G67910 44 / 2e-07 unknown protein
Lus10043217 52 / 2e-10 AT1G52342 48 / 7e-09 unknown protein
Lus10008880 44 / 1e-06 AT5G55980 63 / 1e-13 serine-rich protein-related (.1)
Lus10023632 42 / 2e-06 AT1G67910 48 / 1e-08 unknown protein
Lus10034901 42 / 2e-06 AT1G67910 49 / 6e-09 unknown protein
Lus10023227 43 / 3e-06 AT5G55980 69 / 3e-16 serine-rich protein-related (.1)
Lus10026701 38 / 0.0001 AT1G67910 56 / 5e-12 unknown protein
Lus10038100 39 / 0.0002 AT5G25280 145 / 4e-43 serine-rich protein-related (.1.2)
Lus10006660 39 / 0.0002 AT5G25280 144 / 4e-43 serine-rich protein-related (.1.2)
Lus10000442 37 / 0.0003 AT1G67910 56 / 1e-11 unknown protein
PFAM info
Representative CDS sequence
>Potri.006G159300.1 pacid=42767944 polypeptide=Potri.006G159300.1.p locus=Potri.006G159300 ID=Potri.006G159300.1.v4.1 annot-version=v4.1
ATGTGTCACCCTGGTGTGCTTTCGGTTAGCCAAAGGAACTTGGTGGTGTATCAGAGAAGGCTCGTTTTGCAAGCAGTTGAGACAGAAACTTCACATGCAC
GAACAGAGGTGGCTGCTGGTGGCGGAAGTGCTATTTCTAGATCGATAAACAAGTGTTTGTGTTCACCCACAAGGCACCCGGGATCCTTCAGGTGCAGGCA
CCACCGTTCTGATTATGTGTGGAGTGGGAGAATAACAAGAAAGAAGCAACTCCTTGAAAAGGTATGA
AA sequence
>Potri.006G159300.1 pacid=42767944 polypeptide=Potri.006G159300.1.p locus=Potri.006G159300 ID=Potri.006G159300.1.v4.1 annot-version=v4.1
MCHPGVLSVSQRNLVVYQRRLVLQAVETETSHARTEVAAGGGSAISRSINKCLCSPTRHPGSFRCRHHRSDYVWSGRITRKKQLLEKV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G24577 unknown protein Potri.006G159300 0 1
AT5G53190 SWEET3, AtSWEET... Nodulin MtN3 family protein (.... Potri.012G031400 5.91 0.8499
AT3G63110 ATIPT3 isopentenyltransferase 3 (.1) Potri.014G139300 6.24 0.8403
AT2G30540 Thioredoxin superfamily protei... Potri.014G134300 8.24 0.8398
AT3G58720 RING/U-box superfamily protein... Potri.014G139400 8.48 0.8406
AT1G68740 PHO1;H1 EXS (ERD1/XPR1/SYG1) family pr... Potri.008G110800 9.00 0.8130
AT1G53160 SBP SPL4 squamosa promoter binding prot... Potri.004G046700 11.83 0.8114
AT2G46690 SAUR-like auxin-responsive pro... Potri.014G103300 12.20 0.6672 SAUR24
AT4G31240 protein kinase C-like zinc fin... Potri.006G279400 12.44 0.8188
AT1G10155 ATPP2-A10 phloem protein 2-A10 (.1) Potri.015G120100 13.22 0.8167
AT1G77120 ADH1, ATADH, AT... ARABIDOPSIS THALIANA ALCOHOL D... Potri.005G060000 15.87 0.7920

Potri.006G159300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.