Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13270 228 / 3e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT1G52330 151 / 6e-46 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) AT3G05975 48 / 7e-07 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G54200 42 / 0.0001 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G055000 [exp] 157 / 3e-48 AT1G52330 181 / 1e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.001G180600 [exp] 155 / 3e-47 AT1G52330 192 / 9e-62 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.016G142300 [exp] 50 / 1e-07 AT3G54200 162 / 3e-50 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G112800 [exp] 49 / 4e-07 AT3G54200 159 / 7e-49 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.001G098100 [exp] 42 / 0.0001 AT2G46150 171 / 2e-53 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.011G025100 [exp] 41 / 0.0002 AT2G46150 77 / 3e-17 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.003G141200 [exp] 40 / 0.0005 AT4G23930 176 / 3e-56 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043216 [exp] 228 / 6e-76 AT4G13270 228 / 8e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10011095 [exp] 216 / 4e-71 AT4G13270 234 / 3e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10023631 [exp] 213 / 1e-69 AT4G13270 235 / 2e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10024264 [exp] 178 / 3e-56 AT4G13270 210 / 8e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10011458 [exp] 128 / 9e-37 AT1G52330 168 / 2e-52 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Lus10037534 [exp] 125 / 1e-35 AT1G52330 160 / 2e-49 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Lus10020060 [exp] 52 / 3e-08 AT3G54200 72 / 4e-15 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10006764 [exp] 50 / 1e-07 AT3G54200 79 / 5e-18 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10036403 [exp] 46 / 5e-06 AT2G46150 156 / 8e-48 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007904 [exp] 44 / 4e-05 AT2G46150 159 / 1e-48 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.006G159400.1 pacid=42768594 polypeptide=Potri.006G159400.1.p locus=Potri.006G159400 ID=Potri.006G159400.1.v4.1 annot-version=v4.1 ATGACTTCAAAAACCTCCTCCGTACCGTACACCTCTCTACCTTCCCACCCGGACTCCTATCCCCAAAACGTCATCGTTCTCTCCTACTACCATCGACCTC CAAACCACATCCTCCGCCGCTGTCTCCTCTTCACAACCGCAATCCTCCTCCTCTCGGCCGCCGCCTACCTCCTCTACCCTTCCGACCCGGCGATCCAACT ATCCCGAATCAAACTCAACCACATCCGAGTGAACTCGTCCCCTGAACTTACTCTGGACGTCTCATTCTCCCTCACAATTAAAGTTGAAAACAGGGATTTC TTCTCTCTGGATTACGATTCTCTTGTAGTTTCGGTTGGGTACAGAGGGAGAGAGCTAGGGTTTGTGAATTCAAAGGGAGGGAAAATCAGAGCGAGAAGGA GTTCGTATGTGGATGCAAGGCTTGATTTAAATGGTCTTGAGGTTATAAAGGATGTTTTTTATTTGATTCAGGATTTGGCTAGAGGTGTTATTATTTTCGA TACTGATACACAGGTTAAAGGAGACCTTGGCCTCTTGCTTTTCAAAATTCCCATCAATGGAAGAGTATCATGTCAAGTGTTTGTGAATACAAATAATCAG ACAGTAGAGCATCAAGATTGTTACCCTCAGTGA
AA sequence Show only first row Show all	>Potri.006G159400.1 pacid=42768594 polypeptide=Potri.006G159400.1.p locus=Potri.006G159400 ID=Potri.006G159400.1.v4.1 annot-version=v4.1 MTSKTSSVPYTSLPSHPDSYPQNVIVLSYYHRPPNHILRRCLLFTTAILLLSAAAYLLYPSDPAIQLSRIKLNHIRVNSSPELTLDVSFSLTIKVENRDF FSLDYDSLVVSVGYRGRELGFVNSKGGKIRARRSSYVDARLDLNGLEVIKDVFYLIQDLARGVIIFDTDTQVKGDLGLLLFKIPINGRVSCQVFVNTNNQ TVEHQDCYPQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G13270			Late embryogenesis abundant (L...		Potri.006G159400 [exp]	0	1
AT4G39910		ATUBP3	ubiquitin-specific protease 3 ...		Potri.005G074900 [exp]	2.00	0.7865	Pt-UBP3.2
AT2G14740		VSR2;2, BP80-2;...	VACUOLAR SORTING RECEPTOR 3, V...		Potri.009G088900 [exp]	6.00	0.8047	VSR.1
AT3G48800			Sterile alpha motif (SAM) doma...		Potri.001G062800 [exp]	7.87	0.8108
AT2G16710			Iron-sulphur cluster biosynthe...		Potri.010G238800 [exp]	7.93	0.7199
AT1G04000			unknown protein		Potri.002G259400 [exp]	9.64	0.7897
AT4G16695			unknown protein		Potri.003G078100 [exp]	10.00	0.6994
AT1G50640	AP2_ERF	ATERF3	ethylene responsive element bi...		Potri.001G356100 [exp]	10.19	0.7379	Pt-ERF3.1,ERF40
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Potri.005G026600 [exp]	20.37	0.7796
AT5G11770			NADH-ubiquinone oxidoreductase...		Potri.006G231701 [exp]	20.78	0.7575
AT1G29260		PEX7, ATPEX7	ARABIDOPSIS PEROXIN 7, peroxin...		Potri.004G057600 [exp]	33.36	0.6800	PEX7.1

Compare expression of checked genes

Potri.006G159400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.