Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28850 390 / 9e-138 ATXTH26, XTH26, XTR18 xyloglucan endotransglucosylase/hydrolase 26 (.1) AT5G57530 293 / 2e-99 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1) AT4G25810 289 / 5e-98 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT5G57560 288 / 2e-97 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT4G25820 288 / 2e-97 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1) AT5G57540 286 / 6e-97 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1) AT5G57550 286 / 1e-96 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT3G23730 284 / 9e-96 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT4G14130 281 / 1e-94 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT4G30270 276 / 7e-93 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G084300 [exp] 527 / 0 AT4G28850 403 / 1e-142 xyloglucan endotransglucosylase/hydrolase 26 (.1) Potri.006G170001 [exp] 310 / 6e-106 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.006G169900 [exp] 310 / 6e-106 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.006G170100 [exp] 310 / 6e-106 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G094800 [exp] 303 / 3e-103 AT4G25810 413 / 1e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095200 [exp] 295 / 2e-100 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.002G060400 [exp] 295 / 3e-100 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.018G095100 [exp] 294 / 6e-100 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.002G060500 [exp] 293 / 2e-99 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011112 [exp] 484 / 2e-174 AT4G28850 365 / 1e-127 xyloglucan endotransglucosylase/hydrolase 26 (.1) Lus10012978 [exp] 446 / 2e-159 AT4G28850 359 / 3e-125 xyloglucan endotransglucosylase/hydrolase 26 (.1) Lus10043232 [exp] 340 / 3e-117 AT4G28850 241 / 3e-78 xyloglucan endotransglucosylase/hydrolase 26 (.1) Lus10010938 [exp] 301 / 1e-102 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10031393 [exp] 301 / 1e-102 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010939 [exp] 301 / 2e-102 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031392 [exp] 299 / 1e-101 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010936 [exp] 289 / 6e-98 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10034098 [exp] 284 / 8e-96 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10007349 [exp] 283 / 2e-95 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.006G160700.1 pacid=42769170 polypeptide=Potri.006G160700.1.p locus=Potri.006G160700 ID=Potri.006G160700.1.v4.1 annot-version=v4.1 ATGTCAAGTTTACGAACTTTGTTGGCGGCTCTATTCATCTTTGCAGTAGCATTTGATCCAAGTGCAGTTAATGCCAAATTCTCCAACAGCATGTATTTCT ACTGGGGTGCCCATCATTCGGCAATACTGGGAAATGGCGACGATCTTCAACTTGTGTTGGATCAAACTTCTGGCTCTGGTATTAAATCAAAGCGTCCATT CCTATTTGGAAGCATTCAAATGTTAATCAAGCTGGTGCCTGGGAACTCAGCCGGAACTGTCACAGCCTACTACGTATCCTCTTCTGGAGACAGACATGAC GAAATAGACTTCGAGTTCTTAGGGAATGCATCGGGACAGCCATACACCATCCACACAAACATCTACACTCAAGGAAATGGAAGCAGGGAGCAGCAGTTCC GCCCCTGGTTTGACCCAACTGCTGATTTCCATAACTACACTATACATTGGAATCCTACTGAAGTTGTGTGGTATGTTGATAGTGTGCCAATTCGCGTATT CCGCAACTACGAAAATGAAGGGATTGCTTACCCAAACAAACAGGGCATGAGGGTTTACTCCAGCTTGTGGAATGCTGATATCTGGGCAACTCAAGGTGGG CGAGTTAAGATTGATTGGAAAGTTGCACCATTCATAGCAAGATACCGCAGTTTTAGGGCAAGGGCTTGCAAGTGGAATGGACCAGTTAGCATCAGTCAAT GTGCTTCCAACACCGCAGCTAACTGGTGGACATCCCCTACCTATAGCAAGTTGAGCAATGCCAAATTCGGACAGTTGACGTGGGTCAGAGATAACTACAT GATCTACGACTACTGCAAAGACACTAAGAGGTTCAATGGAAAAACACCACCGGAATGTTTTAAGCCACAGTTCTAA
AA sequence Show only first row Show all	>Potri.006G160700.1 pacid=42769170 polypeptide=Potri.006G160700.1.p locus=Potri.006G160700 ID=Potri.006G160700.1.v4.1 annot-version=v4.1 MSSLRTLLAALFIFAVAFDPSAVNAKFSNSMYFYWGAHHSAILGNGDDLQLVLDQTSGSGIKSKRPFLFGSIQMLIKLVPGNSAGTVTAYYVSSSGDRHD EIDFEFLGNASGQPYTIHTNIYTQGNGSREQQFRPWFDPTADFHNYTIHWNPTEVVWYVDSVPIRVFRNYENEGIAYPNKQGMRVYSSLWNADIWATQGG RVKIDWKVAPFIARYRSFRARACKWNGPVSISQCASNTAANWWTSPTYSKLSNAKFGQLTWVRDNYMIYDYCKDTKRFNGKTPPECFKPQF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Potri.006G160700 [exp]	0	1
AT5G19580			glyoxal oxidase-related protei...		Potri.006G160800 [exp]	1.00	0.9741
AT1G77330			2-oxoglutarate (2OG) and Fe(II...		Potri.002G078600 [exp]	4.24	0.9537	ACO1
AT5G60490		FLA12	FASCICLIN-like arabinogalactan...		Potri.015G013300 [exp]	7.48	0.9363
AT3G08770		LTP6	lipid transfer protein 6 (.1.2...		Potri.011G021900 [exp]	8.71	0.8186
AT4G18335			unknown protein		Potri.004G132400 [exp]	10.58	0.8960
AT1G30760			FAD-binding Berberine family p...		Potri.011G161500 [exp]	11.48	0.9118
AT1G77330			2-oxoglutarate (2OG) and Fe(II...		Potri.005G182700 [exp]	11.48	0.8793	ACO4
AT3G57450			unknown protein		Potri.012G032500 [exp]	11.61	0.9193
AT4G27730		ATOPT6	ARABIDOPSIS THALIANA OLIGOPEPT...		Potri.012G019500 [exp]	12.68	0.9234
AT1G67330			Protein of unknown function (D...		Potri.001G056300 [exp]	13.78	0.9129

Compare expression of checked genes

Potri.006G160700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.