Potri.006G164516 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G46620 62 / 1e-12 zinc finger (C3HC4-type RING finger) family protein (.1)
AT5G64920 57 / 5e-11 CIP8 COP1-interacting protein 8 (.1)
AT3G30460 55 / 1e-10 RING/U-box superfamily protein (.1)
AT3G19950 56 / 2e-10 RING/U-box superfamily protein (.1)
AT1G60360 55 / 3e-10 RING/U-box superfamily protein (.1)
AT2G44330 54 / 3e-10 RING/U-box superfamily protein (.1)
AT3G60080 55 / 5e-10 RING/U-box superfamily protein (.1)
AT3G10815 54 / 6e-10 RING/U-box superfamily protein (.1)
AT1G68180 54 / 6e-10 RING/U-box superfamily protein (.1)
AT5G59550 54 / 7e-10 zinc finger (C3HC4-type RING finger) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G086500 58 / 2e-11 AT4G05350 64 / 2e-12 RING/U-box superfamily protein (.1)
Potri.010G133700 56 / 5e-11 AT3G61460 66 / 4e-14 brassinosteroid-responsive RING-H2 (.1)
Potri.013G116000 57 / 6e-11 AT3G30460 61 / 2e-11 RING/U-box superfamily protein (.1)
Potri.001G243300 57 / 1e-10 AT3G46620 239 / 8e-76 zinc finger (C3HC4-type RING finger) family protein (.1)
Potri.005G062400 56 / 1e-10 AT1G60360 82 / 3e-18 RING/U-box superfamily protein (.1)
Potri.019G032500 56 / 2e-10 AT5G56340 177 / 1e-51 RING/U-box superfamily protein (.1)
Potri.010G201300 56 / 2e-10 AT2G39720 240 / 2e-75 RING-H2 finger C2A (.1)
Potri.001G231000 55 / 2e-10 AT3G60080 100 / 3e-25 RING/U-box superfamily protein (.1)
Potri.010G133300 54 / 2e-10 AT3G61460 69 / 2e-15 brassinosteroid-responsive RING-H2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043027 83 / 7e-22 AT4G26400 57 / 3e-10 RING/U-box superfamily protein (.1.2)
Lus10002637 58 / 4e-11 AT1G55530 257 / 4e-82 RING/U-box superfamily protein (.1)
Lus10020258 58 / 5e-11 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3)
Lus10040783 56 / 3e-10 AT5G59550 228 / 1e-72 zinc finger (C3HC4-type RING finger) family protein (.1)
Lus10001582 54 / 4e-10 AT2G40830 178 / 2e-55 RING-H2 finger C1A (.1.2.3)
Lus10040278 54 / 1e-09 AT5G59550 224 / 2e-71 zinc finger (C3HC4-type RING finger) family protein (.1)
Lus10010179 54 / 1e-09 AT3G19950 285 / 6e-96 RING/U-box superfamily protein (.1)
Lus10017383 52 / 1e-09 AT3G19950 127 / 8e-37 RING/U-box superfamily protein (.1)
Lus10024372 54 / 2e-09 AT5G59550 197 / 5e-60 zinc finger (C3HC4-type RING finger) family protein (.1)
Lus10004712 53 / 2e-09 AT5G59550 294 / 6e-97 zinc finger (C3HC4-type RING finger) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.006G164516.1 pacid=42767384 polypeptide=Potri.006G164516.1.p locus=Potri.006G164516 ID=Potri.006G164516.1.v4.1 annot-version=v4.1
ATGGCATCAAACCCTTTTTCGAGCTGTCTAATCGATACGAGCTTTGATCTCGATGAGGCCCTAACCCTGCCTCAGAATTTAAGCCAACAAATCACATATT
CAAACTCTACCATTGTAGCTGATATGCCCACGGCACTTACTACAGGTGATGCTGTTTGCGCAGTTTGCATGGAGGGTTTCCAGTCAGGTATAGGCGGTAA
AAAAGTCCCATGTGGGCATGTCTACCATGAAGCTTGCATCTCCGCCTTGCTCTCCCACCGCCACTCTTGTCCTCTCTGCCGCTGTGACATCTCCGGCTAG
AA sequence
>Potri.006G164516.1 pacid=42767384 polypeptide=Potri.006G164516.1.p locus=Potri.006G164516 ID=Potri.006G164516.1.v4.1 annot-version=v4.1
MASNPFSSCLIDTSFDLDEALTLPQNLSQQITYSNSTIVADMPTALTTGDAVCAVCMEGFQSGIGGKKVPCGHVYHEACISALLSHRHSCPLCRCDISG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G46620 zinc finger (C3HC4-type RING f... Potri.006G164516 0 1
AT3G62270 HCO3- transporter family (.1) Potri.015G077600 2.44 0.9217
Potri.002G068501 2.82 0.9121
AT3G06880 Transducin/WD40 repeat-like su... Potri.008G220800 3.74 0.8233
AT1G49800 unknown protein Potri.001G299900 4.00 0.8195
AT1G21360 GLTP2 glycolipid transfer protein 2 ... Potri.002G071100 4.69 0.8015
AT5G37060 ATCHX24 cation/H+ exchanger 24, ARABID... Potri.009G078000 5.00 0.7975
AT5G25260 SPFH/Band 7/PHB domain-contain... Potri.006G258900 5.47 0.8820
AT5G17680 disease resistance protein (TI... Potri.019G070700 5.65 0.8677
AT1G49570 Peroxidase superfamily protein... Potri.004G144600 7.74 0.8516
AT4G38840 SAUR-like auxin-responsive pro... Potri.004G164600 7.93 0.8017 SAUR68

Potri.006G164516 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.