Plant FIBer expression Database

Potri.006G166832 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G425366
[exp]
144 / 1e-45 ND /
Potri.001G427901
[exp]
100 / 1e-28 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.006G166832.1 pacid=42769022 polypeptide=Potri.006G166832.1.p locus=Potri.006G166832 ID=Potri.006G166832.1.v4.1 annot-version=v4.1
ATGATGAGCTGGTGCGGTTGGTGGTGTTGCTGCGACTGCTCTTCCTCCTCTCTGGTGTTGTTGGGCTGCCTTTCCTCCTCGTCTGTGCAGTTGCTGGTGC
AGTTGGTGGTGTTGCCATTTTCGTCTACTGGCTTCTTGTTTCCTCCTCTTTCTATCTGCCTTCGGGTTCCTCTGGTGCTGGTGCTTGCTGAAGATGGAGG
TCGGGAAGGATATCCTGCTGTCATGTTACTGCTGCTGTTTGCTGCTTCAGGAGGAAGGATCCGGCTATTGTGCTGTTCTTGCTTATTGCTGCTCAAAGTG
GCTGAGGAATTGCAACTGGTGATGACCGCGCCCCTGCTGGTTCATGCTCCCAGTGCAGAGCAGAACACAGCTACTGCTGGCGACGGGGAAAAGATATAG
AA sequence
>Potri.006G166832.1 pacid=42769022 polypeptide=Potri.006G166832.1.p locus=Potri.006G166832 ID=Potri.006G166832.1.v4.1 annot-version=v4.1
MMSWCGWWCCCDCSSSSLVLLGCLSSSSVQLLVQLVVLPFSSTGFLFPPLSICLRVPLVLVLAEDGGREGYPAVMLLLLFAASGGRIRLLCCSCLLLLKV
AEELQLVMTAPLLVHAPSAEQNTATAGDGEKI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G166832
[exp]
0 1
Potri.001G427901
[exp]
4.47 0.9405
AT2G38300 GARP myb-like HTH transcriptional r... Potri.004G057900
[exp]
5.09 0.9343
Potri.010G007877
[exp]
6.48 0.9246
Potri.001G425366
[exp]
6.63 0.9305
AT4G17810 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers sup... Potri.002G041600
[exp]
14.17 0.9341
AT2G44340 VQ motif-containing protein (.... Potri.001G230800
[exp]
17.20 0.9222
AT4G17800 AT-hook Predicted AT-hook DNA-binding ... Potri.003G091300
[exp]
20.85 0.9288
AT5G45800 MEE62 maternal effect embryo arrest ... Potri.011G067900
[exp]
21.90 0.9155
AT2G45430 AT-hook AHL22 AT-hook motif nuclear-localize... Potri.002G149300
[exp]
23.87 0.9282
AT2G29150 NAD(P)-binding Rossmann-fold s... Potri.006G089800
[exp]
28.93 0.9208

Potri.006G166832 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.