Potri.006G166850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G142940 85 / 2e-22 ND /
Potri.011G073216 79 / 1e-19 ND /
Potri.010G007877 77 / 3e-19 ND /
Potri.001G108450 65 / 3e-14 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.006G166850.1 pacid=42768081 polypeptide=Potri.006G166850.1.p locus=Potri.006G166850 ID=Potri.006G166850.1.v4.1 annot-version=v4.1
ATGAAAGAAAATGGCAGTAAAAGGAGGAAAACAGAGGGGAAGAGGAGAACGGTAACCTGTCTCTCTGCTCTCTCCCTCCACCGTTTGGAAGCACACCGCC
ACCTTCCTGACCACCGTGAGGCATTGTCGGCTTCCTCCCAACACCACCAGATTCTCCCCCACGATCCAGCAGCTTCTCTTAAGACCAGCCAAAATCGTGA
GCCACAAGCAGCGTCAGGAGTTTTGCTTCACATTCCAAACAGACAGCTCTTCTCTGAGTCCCGCACCAGTACGCAGCCATCTCCAGCCTCAACAACGGCG
TCGTCTTCAGCTCCAGCAGCCATCGCTGACTAG
AA sequence
>Potri.006G166850.1 pacid=42768081 polypeptide=Potri.006G166850.1.p locus=Potri.006G166850 ID=Potri.006G166850.1.v4.1 annot-version=v4.1
MKENGSKRRKTEGKRRTVTCLSALSLHRLEAHRHLPDHREALSASSQHHQILPHDPAASLKTSQNREPQAASGVLLHIPNRQLFSESRTSTQPSPASTTA
SSSAPAAIAD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G166850 0 1
Potri.004G114450 7.07 0.7621
AT1G16060 AP2_ERF ADAP ARIA-interacting double AP2 do... Potri.001G041500 10.19 0.7703
AT2G43360 BIOB, BIO2 BIOTIN AUXOTROPH B, BIOTIN AUX... Potri.007G126400 19.49 0.7145 BIO2.1
AT3G43720 Bifunctional inhibitor/lipid-t... Potri.009G158100 25.05 0.7283
AT1G01120 KCS1 3-ketoacyl-CoA synthase 1 (.1) Potri.002G178000 25.59 0.7278 Pt-KCS1.1
AT1G34300 lectin protein kinase family p... Potri.019G086300 28.46 0.7216
AT5G12970 Calcium-dependent lipid-bindin... Potri.003G210801 33.34 0.7155
AT3G45070 P-loop containing nucleoside t... Potri.010G138400 35.79 0.7188
AT5G19260 FAF3 FANTASTIC FOUR 3, Protein of u... Potri.010G091800 36.74 0.6336
AT4G14940 ATAO1 amine oxidase 1 (.1) Potri.010G088900 37.94 0.7124

Potri.006G166850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.