Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57520 93 / 1e-24 C2H2ZnF ATZFP2, ZFP2 zinc finger protein 2 (.1) AT5G25160 75 / 8e-17 C2H2ZnF ZFP3 zinc finger protein 3 (.1) AT1G66140 74 / 3e-16 C2H2ZnF ZFP4 zinc finger protein 4 (.1) AT1G80730 72 / 7e-16 C2H2ZnF ATZFP1, ZFP1 ARABIDOPSIS THALIANA ZINC-FINGER PROTEIN 1, zinc-finger protein 1 (.1) AT5G10970 72 / 1e-15 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT1G24625 71 / 1e-15 C2H2ZnF ZFP7 zinc finger protein 7 (.1) AT5G14010 60 / 1e-11 C2H2ZnF KNUCKLES, KNU KNUCKLES, C2H2 and C2HC zinc fingers superfamily protein (.1) AT5G01860 61 / 2e-11 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT3G58070 58 / 2e-10 C2H2ZnF GIS GLABROUS INFLORESCENCE STEMS, C2H2 and C2HC zinc fingers superfamily protein (.1) AT5G27880 56 / 2e-09 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G094300 [exp] 241 / 1e-82 AT5G57520 108 / 9e-31 zinc finger protein 2 (.1) Potri.003G180600 [exp] 75 / 1e-16 AT5G10970 144 / 1e-41 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.006G261700 [exp] 74 / 3e-16 AT5G10970 166 / 4e-50 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.001G047500 [exp] 74 / 3e-16 AT5G10970 143 / 5e-41 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.004G084100 [exp] 74 / 4e-16 AT1G66140 164 / 6e-50 zinc finger protein 4 (.1) Potri.017G134800 [exp] 73 / 4e-16 AT1G66140 165 / 3e-50 zinc finger protein 4 (.1) Potri.018G021400 [exp] 74 / 5e-16 AT5G10970 165 / 8e-50 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.010G102700 [exp] 72 / 9e-16 AT1G66140 157 / 4e-47 zinc finger protein 4 (.1) Potri.008G138000 [exp] 72 / 1e-15 AT1G66140 155 / 2e-46 zinc finger protein 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025471 [exp] 89 / 6e-23 AT5G57520 92 / 3e-24 zinc finger protein 2 (.1) Lus10006960 [exp] 82 / 5e-20 AT5G57520 92 / 2e-24 zinc finger protein 2 (.1) Lus10014350 [exp] 72 / 9e-16 AT1G80730 110 / 1e-29 ARABIDOPSIS THALIANA ZINC-FINGER PROTEIN 1, zinc-finger protein 1 (.1) Lus10013243 [exp] 71 / 1e-14 AT1G66140 125 / 3e-34 zinc finger protein 4 (.1) Lus10030764 [exp] 70 / 1e-14 AT1G66140 124 / 1e-33 zinc finger protein 4 (.1) Lus10003681 [exp] 69 / 2e-14 AT1G24625 112 / 9e-31 zinc finger protein 7 (.1) Lus10028997 [exp] 67 / 3e-14 AT1G24625 103 / 1e-27 zinc finger protein 7 (.1) Lus10018328 [exp] 62 / 2e-12 AT5G10970 94 / 6e-24 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10017125 [exp] 62 / 3e-12 AT5G10970 95 / 4e-24 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10026121 [exp] 64 / 4e-12 AT5G10970 85 / 1e-18 C2H2 and C2HC zinc fingers superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G169800.2 pacid=42769439 polypeptide=Potri.006G169800.2.p locus=Potri.006G169800 ID=Potri.006G169800.2.v4.1 annot-version=v4.1 ATGGATTTCCAACCAAATACTTCTCTACATCTAAGCCTACCAAGCAATCAACTAAACCTAGAACTTGTACTTGAGCCATCTTCTTCATCATCACGTCATA GTCCAGCAGAACCTCGAATTTTCTCATGCAACTATTGCCAAAGAAAGTTTTATAGCTCACAAGCTCTTGGTGGTCACCAAAATGCTCACAAGCTTGAGAG AACCTTAGCCAAGAAGAGCAGAGAGATGAGTTCATCCGTACGGGCACACGGAGGATCGAACCCACGGTCAGAATCATCATATAGCATGAGTGGCTCAACC TATCCTCGAGACCATCAGCCAGCCCTAGCAGGGTTCGAGCACCATGGACATGCTGGTAGGATTGTTGGTGGCTTGAGCTATGGCAGGACAGAGATGAATT ACGGTTCTAGAGAAGGTATTGGGGGTTCTTGGTCCATGGTATACAGAACCGAAAATGTTCAAGAAGAGTTGAGCCAACTTGACTTGTCTTTAAGGCTTTG A
AA sequence Show only first row Show all	>Potri.006G169800.2 pacid=42769439 polypeptide=Potri.006G169800.2.p locus=Potri.006G169800 ID=Potri.006G169800.2.v4.1 annot-version=v4.1 MDFQPNTSLHLSLPSNQLNLELVLEPSSSSSRHSPAEPRIFSCNYCQRKFYSSQALGGHQNAHKLERTLAKKSREMSSSVRAHGGSNPRSESSYSMSGST YPRDHQPALAGFEHHGHAGRIVGGLSYGRTEMNYGSREGIGGSWSMVYRTENVQEELSQLDLSLRL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G57520	C2H2ZnF	ATZFP2, ZFP2	zinc finger protein 2 (.1)		Potri.006G169800 [exp]	0	1
AT4G20970	bHLH	bHLH162	basic helix-loop-helix (bHLH) ...		Potri.012G079100 [exp]	3.46	0.8979
AT1G64110		DAA1	DUO1-activated ATPase 1, P-loo...		Potri.001G097600 [exp]	4.35	0.8265
AT1G58122		CPuORF45	conserved peptide upstream ope...		Potri.002G104450 [exp]	9.48	0.8398
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Potri.002G150500 [exp]	9.79	0.8370	CYP76.3
AT3G61460		BRH1	brassinosteroid-responsive RIN...		Potri.010G133200 [exp]	9.94	0.8404
AT3G61460		BRH1	brassinosteroid-responsive RIN...		Potri.010G133300 [exp]	13.96	0.8287
					Potri.015G098950 [exp]	14.17	0.7641
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Potri.015G032100 [exp]	20.24	0.8841	TPS1.4
AT4G27290			S-locus lectin protein kinase ...		Potri.011G125801 [exp]	21.35	0.8770
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Potri.005G106100 [exp]	29.12	0.8769	Pt-CTS2.5

Compare expression of checked genes

Potri.006G169800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.