Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25810 379 / 2e-133 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT5G57560 373 / 5e-131 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT3G23730 358 / 3e-125 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT5G48070 352 / 8e-123 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1) AT5G57550 349 / 2e-121 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT5G57540 348 / 2e-121 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1) AT5G57530 345 / 5e-120 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1) AT4G14130 345 / 6e-120 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT4G30270 342 / 5e-119 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT4G25820 342 / 2e-118 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G170001 [exp] 598 / 0 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.006G170100 [exp] 598 / 0 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095100 [exp] 405 / 2e-143 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095200 [exp] 400 / 1e-141 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.013G005700 [exp] 387 / 9e-136 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.014G146100 [exp] 384 / 3e-135 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.018G094800 [exp] 379 / 5e-133 AT4G25810 413 / 1e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G094900 [exp] 372 / 2e-130 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.005G201250 [exp] 367 / 1e-128 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010939 [exp] 363 / 6e-127 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10031393 [exp] 361 / 3e-126 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010938 [exp] 359 / 2e-125 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10031392 [exp] 358 / 3e-125 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010936 [exp] 354 / 2e-123 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10003048 [exp] 351 / 2e-122 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10034098 [exp] 351 / 3e-122 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10028947 [exp] 350 / 8e-122 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10000678 [exp] 348 / 4e-121 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10021638 [exp] 341 / 2e-118 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.006G169900.1 pacid=42768350 polypeptide=Potri.006G169900.1.p locus=Potri.006G169900 ID=Potri.006G169900.1.v4.1 annot-version=v4.1 ATGAAAGCAGGGCTGCTAGTCTCTCTGATAGTAAACTTTCTGGTGGTTGCTTCTGCCGGCAGCTTCTACAATGATTTTTATTTCAACTGGGGACATGACC ACGGTAAGGTATACGACAATGGCAATGGTCTGAGCCTCATTCTTGACAAAAATTCTGGATCAGGGTTTCAATCCAAGAAAGAGTATTTATTTGGTAAGAT TGATATCCAGCTCAAGCTTGTCCATGGCAATTCGGCCGGCACTGTCACTACATTTTATCTATCCTCTCTAGGGCCATACCACGATGAGATAGACTTCGAA TTCTTGGGAAATACAAGTGGTCAGCCATACACTCTTCACACTAACGTGTTCAGCCAAGGCAAAGGTAACAGAGAGCAGCAATTCTATCTTTGGTTTGACC CCACTGCTGATTTCCACACGTATTCTATCCTTTGGAATCCACAACGCATAATTTTTTCAGTTGATGGCATTGCAATTAGAGAATTCAAGAACTTAGAATC CATTGGCGTTCCATTCCCTAAGAACCAACCAATGAGGATTTACTCCAGTCTTTGGGAAGCTGATGACTGGGCAACATGTGGTGGAAGAGTTAAGACAGAT TGGACAAAAGCACCCTTCGTTGCTTCGTTTAGGAACTTCAACGTCAATGCCTGTGCTTGGTCTTACGGAGCATCTTCTTGTAAATCAAAATCTGGCTTTG CTGACTCCATCAGCAACTCATGGATCTGGGAAGAGCTCGATGTCGGACGCGAAGGCCAGATGAAATGGGTGCGGGACAATTACATGACCTATGACTATTG CAAAGATTCCAAGCGATTCCCACACGGCCTCCCTCGTGAGTGCTATGTCACCAACTTTCCCTGA
AA sequence Show only first row Show all	>Potri.006G169900.1 pacid=42768350 polypeptide=Potri.006G169900.1.p locus=Potri.006G169900 ID=Potri.006G169900.1.v4.1 annot-version=v4.1 MKAGLLVSLIVNFLVVASAGSFYNDFYFNWGHDHGKVYDNGNGLSLILDKNSGSGFQSKKEYLFGKIDIQLKLVHGNSAGTVTTFYLSSLGPYHDEIDFE FLGNTSGQPYTLHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGIAIREFKNLESIGVPFPKNQPMRIYSSLWEADDWATCGGRVKTD WTKAPFVASFRNFNVNACAWSYGASSCKSKSGFADSISNSWIWEELDVGREGQMKWVRDNYMTYDYCKDSKRFPHGLPRECYVTNFP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.006G169900 [exp]	0	1
AT1G11925			Stigma-specific Stig1 family p...		Potri.010G228100 [exp]	8.83	0.7489
AT5G20045			unknown protein		Potri.008G015100 [exp]	21.63	0.5748
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.006G170001 [exp]	23.87	0.7243
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.006G170100 [exp]	26.43	0.7381
AT5G21105			Plant L-ascorbate oxidase (.1....		Potri.009G159700 [exp]	38.07	0.6412	AO1.4
AT1G68090		ANN5, ANNAT5	ANNEXIN ARABIDOPSIS THALIANA 5...		Potri.008G139500 [exp]	40.98	0.6628	Pt-ANN5.2
AT3G05390			unknown protein		Potri.004G231100 [exp]	45.05	0.7238
AT3G51930			Transducin/WD40 repeat-like su...		Potri.001G022900 [exp]	64.14	0.6828
AT4G02270		RHS13	root hair specific 13 (.1)		Potri.017G145800 [exp]	75.01	0.6773
AT1G66400		CML23	calmodulin like 23 (.1)		Potri.014G030900 [exp]	84.88	0.6424

Compare expression of checked genes

Potri.006G169900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.