Potri.006G170001 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25810 379 / 2e-133 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57560 373 / 5e-131 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT3G23730 358 / 3e-125 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT5G48070 352 / 8e-123 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
AT5G57550 349 / 2e-121 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57540 348 / 2e-121 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT5G57530 345 / 5e-120 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT4G14130 345 / 6e-120 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT4G30270 342 / 5e-119 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT4G25820 342 / 2e-118 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G169900 598 / 0 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.006G170100 598 / 0 AT4G25810 380 / 1e-133 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 405 / 2e-143 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 400 / 1e-141 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.013G005700 387 / 9e-136 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.014G146100 384 / 3e-135 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.018G094800 379 / 5e-133 AT4G25810 413 / 1e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G094900 372 / 2e-130 AT4G25810 410 / 8e-146 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.005G201250 367 / 1e-128 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010939 363 / 6e-127 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 361 / 3e-126 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 359 / 2e-125 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031392 358 / 3e-125 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010936 354 / 2e-123 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10003048 351 / 2e-122 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10034098 351 / 3e-122 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10028947 350 / 8e-122 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10000678 348 / 4e-121 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10021638 341 / 2e-118 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Potri.006G170001.1 pacid=42770512 polypeptide=Potri.006G170001.1.p locus=Potri.006G170001 ID=Potri.006G170001.1.v4.1 annot-version=v4.1
ATGAAAGCAGGGCTGCTAGTCTCTCTGATAGTAAACTTTCTGGTGGTTGCTTCTGCCGGCAGCTTCTACAATGATTTTTATTTCAACTGGGGACATGACC
ACGGTAAGGTATACGACAATGGCAATGGTCTGAGCCTCATTCTTGACAAAAATTCTGGATCAGGGTTTCAATCCAAGAAAGAGTATTTATTTGGTAAGAT
TGATATCCAGCTCAAGCTTGTCCATGGCAATTCGGCCGGCACTGTCACTACATTTTATCTATCCTCTCTAGGGCCATACCACGATGAGATAGACTTCGAA
TTCTTGGGAAATACAAGTGGTCAGCCATACACTCTTCACACTAACGTGTTCAGCCAAGGCAAAGGTAACAGAGAGCAGCAATTCTATCTTTGGTTTGACC
CCACTGCTGATTTCCACACGTATTCTATCCTTTGGAATCCACAACGCATAATTTTTTCAGTTGATGGCATTGCAATTAGAGAATTCAAGAACTTAGAATC
CATTGGCGTTCCATTCCCTAAGAACCAACCAATGAGGATTTACTCCAGTCTTTGGGAAGCTGATGACTGGGCAACATGTGGTGGAAGAGTTAAGACAGAT
TGGACAAAAGCACCCTTCGTTGCTTCGTTTAGGAACTTCAACGTCAATGCCTGTGCTTGGTCTTACGGAGCATCTTCTTGTAAATCAAAATCTGGCTTTG
CTGACTCCATCAGCAACTCATGGATCTGGGAAGAGCTCGATGTCGGACGCGAAGGCCAGATGAAATGGGTGCGGGACAATTACATGACCTATGACTATTG
CAAAGATTCCAAGCGATTCCCACACGGCCTCCCTCGTGAGTGCTATGTCACCAACTTTCCCTGA
AA sequence
>Potri.006G170001.1 pacid=42770512 polypeptide=Potri.006G170001.1.p locus=Potri.006G170001 ID=Potri.006G170001.1.v4.1 annot-version=v4.1
MKAGLLVSLIVNFLVVASAGSFYNDFYFNWGHDHGKVYDNGNGLSLILDKNSGSGFQSKKEYLFGKIDIQLKLVHGNSAGTVTTFYLSSLGPYHDEIDFE
FLGNTSGQPYTLHTNVFSQGKGNREQQFYLWFDPTADFHTYSILWNPQRIIFSVDGIAIREFKNLESIGVPFPKNQPMRIYSSLWEADDWATCGGRVKTD
WTKAPFVASFRNFNVNACAWSYGASSCKSKSGFADSISNSWIWEELDVGREGQMKWVRDNYMTYDYCKDSKRFPHGLPRECYVTNFP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Potri.006G170001 0 1
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Potri.006G170100 6.40 0.8822
AT4G02270 RHS13 root hair specific 13 (.1) Potri.017G145800 8.00 0.8616
AT3G61430 ATPIP1, PIP1;1,... PLASMA MEMBRANE INTRINSIC PROT... Potri.004G167000 10.53 0.8754
AT1G04350 2-oxoglutarate (2OG) and Fe(II... Potri.004G083100 12.88 0.6691
AT2G04100 MATE efflux family protein (.1... Potri.004G094800 16.79 0.8532
AT4G25250 Plant invertase/pectin methyle... Potri.015G128900 17.46 0.8597
Potri.006G017750 18.52 0.8466
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Potri.006G169900 23.87 0.7243
AT2G31083 AtCLE5, CLE5, C... CLAVATA3/ESR-RELATED 5 (.1) Potri.019G090800 25.49 0.8353 CLE4.1
AT1G71140 MATE efflux family protein (.1... Potri.004G094900 26.83 0.8385

Potri.006G170001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.