Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17050 254 / 1e-82 UGT78D2 UDP-glucosyl transferase 78D2 (.1) AT5G17030 244 / 7e-79 UGT78D3 UDP-glucosyl transferase 78D3 (.1) AT5G17040 236 / 1e-75 UDP-Glycosyltransferase superfamily protein (.1) AT1G30530 212 / 2e-66 UGT78D1 UDP-glucosyl transferase 78D1 (.1) AT5G59580 164 / 5e-48 UGT76E1 UDP-glucosyl transferase 76E1 (.1) AT5G59590 160 / 2e-46 UGT76E2 UDP-glucosyl transferase 76E2 (.1) AT5G05880 160 / 2e-46 UDP-Glycosyltransferase superfamily protein (.1) AT5G05890 158 / 1e-45 UDP-Glycosyltransferase superfamily protein (.1) AT3G46660 158 / 2e-45 UGT76E12 UDP-glucosyl transferase 76E12 (.1) AT1G22400 156 / 1e-44 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G171156 [exp] 501 / 0 AT5G17050 343 / 1e-115 UDP-glucosyl transferase 78D2 (.1) Potri.006G171100 [exp] 503 / 2e-180 AT5G17050 392 / 2e-133 UDP-glucosyl transferase 78D2 (.1) Potri.006G171268 [exp] 500 / 3e-179 AT5G17050 389 / 5e-132 UDP-glucosyl transferase 78D2 (.1) Potri.018G096000 [exp] 324 / 4e-110 AT5G17050 408 / 1e-139 UDP-glucosyl transferase 78D2 (.1) Potri.013G118700 [exp] 271 / 3e-89 AT5G17050 533 / 0.0 UDP-glucosyl transferase 78D2 (.1) Potri.013G143900 [exp] 268 / 4e-88 AT5G17050 518 / 0.0 UDP-glucosyl transferase 78D2 (.1) Potri.009G078400 [exp] 185 / 9e-56 AT5G17050 358 / 6e-120 UDP-glucosyl transferase 78D2 (.1) Potri.009G133300 [exp] 184 / 4e-55 AT5G17050 371 / 8e-125 UDP-glucosyl transferase 78D2 (.1) Potri.002G098400 [exp] 162 / 7e-47 AT1G22360 640 / 0.0 UDP-glucosyl transferase 85A2 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025854 [exp] 234 / 2e-74 AT5G17050 523 / 0.0 UDP-glucosyl transferase 78D2 (.1) Lus10013921 [exp] 160 / 6e-48 AT1G22380 320 / 3e-107 UDP-glucosyl transferase 85A3 (.1) Lus10013922 [exp] 159 / 1e-45 AT1G22400 533 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10013919 [exp] 152 / 6e-45 AT1G22380 318 / 2e-106 UDP-glucosyl transferase 85A3 (.1) Lus10004671 [exp] 156 / 1e-44 AT3G55700 450 / 4e-156 UDP-Glycosyltransferase superfamily protein (.1) Lus10014148 [exp] 154 / 8e-44 AT2G43840 407 / 2e-139 UDP-glycosyltransferase 74 F1 (.1.2) Lus10013923 [exp] 154 / 8e-44 AT1G22400 537 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10013920 [exp] 152 / 5e-43 AT1G22400 488 / 3e-170 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10040246 [exp] 150 / 1e-42 AT3G11340 488 / 3e-171 UDP-dependent glycosyltransferase 76B1, UDP-Glycosyltransferase superfamily protein (.1) Lus10040725 [exp] 147 / 1e-41 AT5G59590 408 / 9e-140 UDP-glucosyl transferase 76E2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0113 [poplar] [flax] GT-B PF00201 [poplar] [flax] UDPGT UDP-glucoronosyl and UDP-glucosyl transferase
Representative CDS sequence Show only first row Show all	>Potri.006G171128.1 pacid=42767634 polypeptide=Potri.006G171128.1.p locus=Potri.006G171128 ID=Potri.006G171128.1.v4.1 annot-version=v4.1 ATGTTGTGTAAAATGGGATTAGCATTGCCACAGGCAGCTGTTGTTGCTTCAAACTCTTTTGAAGAATTAGACCCCGATGCGGTGATTCTGTTCAAGTCAA GGCTTCCCAAGTTTCTCAACATCGGCCCCTTCGTGTTGACATCTCCAGATCCGTTCATGTCTGATCCACACGGTTGCCTAGAGTGGCTGGACAAGCAGAA ACAAGAATTTGTGGTGTACATTAGTTTTGGAAGTGTGATAACGCTACCACCCCAAGAGTTAGCAGAGTTAGTAGAAGCGTTAAAGGAATGCAAGTTGCCA TTTCTTTGGTCATTTAGAGGCAATCCTAAGGAAGAATTGCCTGAAGAGTTCTTAGAAAGGACTAAAGAGAAGGGAAAAGTAGTTTCATGGACTCCGCAGT TAAAAGTCTTGCGACACAAAGCAATCAGAGTGTTTGTGACACATAGTGGGTGGAACTCGGTTTTAGATAGTATTGCTGGATGTGTGCCTATGATTTGCAG GCCATTCTTTGGGGATCAAACAGTGAACATGAGGACTATAGAGGCAGTATGGGGTACTGGCCTCGAGATTGAAGGAGGAAGAATCACAAAAGGAGGTTTG ATGAAAGCCATGAGGCTTATTATGTCAACCGATGAAGGGAACAAAATGAGAAAGAAACTTCAACACCTCCAAGGTCTTGCTTTGGATGCCATGCAATCAA GTGGCAGCTCTACCAAAAATTTCGAAACTCTGTTAAAGGTGGTCGCCAAGTAA
AA sequence Show only first row Show all	>Potri.006G171128.1 pacid=42767634 polypeptide=Potri.006G171128.1.p locus=Potri.006G171128 ID=Potri.006G171128.1.v4.1 annot-version=v4.1 MLCKMGLALPQAAVVASNSFEELDPDAVILFKSRLPKFLNIGPFVLTSPDPFMSDPHGCLEWLDKQKQEFVVYISFGSVITLPPQELAELVEALKECKLP FLWSFRGNPKEELPEEFLERTKEKGKVVSWTPQLKVLRHKAIRVFVTHSGWNSVLDSIAGCVPMICRPFFGDQTVNMRTIEAVWGTGLEIEGGRITKGGL MKAMRLIMSTDEGNKMRKKLQHLQGLALDAMQSSGSSTKNFETLLKVVAK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G17050		UGT78D2	UDP-glucosyl transferase 78D2 ...		Potri.006G171128 [exp]	0	1
AT5G17050		UGT78D2	UDP-glucosyl transferase 78D2 ...		Potri.006G171156 [exp]	1.00	0.9989
AT5G17050		UGT78D2	UDP-glucosyl transferase 78D2 ...		Potri.006G171100 [exp]	2.00	0.9955
AT2G31180	MYB	ATMYB14, Myb14a...	ARABIDOPSIS THALIANA MYB DOMAI...		Potri.013G149200 [exp]	3.87	0.9749
AT5G17050		UGT78D2	UDP-glucosyl transferase 78D2 ...		Potri.006G171268 [exp]	4.00	0.9891
AT5G07990		CYP75B1, D501, ...	TRANSPARENT TESTA 7, CYTOCHROM...		Potri.018G051300 [exp]	5.47	0.9384
AT5G17540			HXXXD-type acyl-transferase fa...		Potri.013G074500 [exp]	10.24	0.8685
AT5G07990		CYP75B1, D501, ...	TRANSPARENT TESTA 7, CYTOCHROM...		Potri.003G066600 [exp]	10.39	0.9470
AT5G62200			Embryo-specific protein 3, (AT...		Potri.015G132900 [exp]	10.58	0.9420
					Potri.002G249550 [exp]	10.72	0.8605
AT5G16370		AAE5	acyl activating enzyme 5 (.1)		Potri.015G148500 [exp]	11.53	0.8853

Compare expression of checked genes

Potri.006G171128 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.