Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30320 192 / 1e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 183 / 3e-59 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 180 / 5e-58 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25780 167 / 3e-53 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 156 / 9e-49 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G19690 153 / 4e-48 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 152 / 1e-47 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT3G09590 144 / 6e-44 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G01310 145 / 8e-44 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33730 141 / 4e-43 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G096007 [exp] 265 / 4e-92 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083100 [exp] 162 / 2e-51 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 161 / 4e-51 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 155 / 9e-49 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G007000 [exp] 152 / 3e-47 AT4G31470 185 / 6e-60 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083600 [exp] 144 / 1e-44 AT1G50060 205 / 1e-68 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.018G096028 [exp] 143 / 6e-43 AT4G25780 219 / 3e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082900 [exp] 140 / 1e-42 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.001G288600 [exp] 137 / 2e-41 AT2G14610 214 / 6e-72 pathogenesis-related gene 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006980 [exp] 213 / 2e-71 AT4G30320 203 / 1e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10001319 [exp] 213 / 2e-71 AT4G30320 201 / 6e-67 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10015522 [exp] 207 / 7e-69 AT4G30320 199 / 7e-66 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10019993 [exp] 206 / 4e-68 AT4G30320 197 / 7e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10013693 [exp] 163 / 8e-52 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10005557 [exp] 160 / 1e-50 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006981 [exp] 148 / 1e-45 AT4G25780 235 / 2e-79 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10020491 [exp] 144 / 2e-44 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10020493 [exp] 144 / 2e-44 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10012479 [exp] 144 / 3e-44 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [poplar] [flax] CAP PF00188 [poplar] [flax] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Potri.006G171300.1 pacid=42767343 polypeptide=Potri.006G171300.1.p locus=Potri.006G171300 ID=Potri.006G171300.1.v4.1 annot-version=v4.1 ATGCATACTCGTTATGCTACCATCTCCATTTTTATCCTTCTCATTTCCAGCACACATGCTGTCTTCACCAGACGACCACACCCTTACCTCAGTGCGGCAA ACCAATTCATGGCTCCTCAAAATGCTGCCCGTGCCTCTTTGAGGATTCGGCCATTAGTGTGGGATGCAAATTTGGCACGTTACGCGCAATCGTATTGCAA TCAAAGGCGCTACGACTGTGATTTAAAGCATTCTAATGGACCATACGGTGAGAACATCTTCTGGGGCAGTGGCAGTGGTTGGAGTCCAGCTCAGGCCGCC GCCGCATGGGTCTCGGAGCGTAAATGGTATGATTATTGGTCTAATTCTTGTGCCGAGGATCAAGAATGTGGACATTATACTCAAATTGTTTGGAACAGCA CAGAAAGAATTGGGTGTGCTAGGGTGGATTGTTTTCGTGGAAGGGGAGTTTTCATGTCTTGCAACTATGATCCTCCTGGGAATTATATTGGAGAAAAGCC TTATTGA
AA sequence Show only first row Show all	>Potri.006G171300.1 pacid=42767343 polypeptide=Potri.006G171300.1.p locus=Potri.006G171300 ID=Potri.006G171300.1.v4.1 annot-version=v4.1 MHTRYATISIFILLISSTHAVFTRRPHPYLSAANQFMAPQNAARASLRIRPLVWDANLARYAQSYCNQRRYDCDLKHSNGPYGENIFWGSGSGWSPAQAA AAWVSERKWYDYWSNSCAEDQECGHYTQIVWNSTERIGCARVDCFRGRGVFMSCNYDPPGNYIGEKPY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G30320			CAP (Cysteine-rich secretory p...		Potri.006G171300 [exp]	0	1
AT5G39240			unknown protein		Potri.017G093000 [exp]	1.73	0.8505
AT3G25860		PLE2, LTA2	PLASTID E2 SUBUNIT OF PYRUVATE...		Potri.010G126600 [exp]	3.16	0.8409
AT5G10160			Thioesterase superfamily prote...		Potri.003G020300 [exp]	4.47	0.8358
AT5G13100			unknown protein		Potri.003G168300 [exp]	5.29	0.7738
AT5G51750		ATSBT1.3	subtilase 1.3 (.1)		Potri.015G133800 [exp]	6.00	0.8310
AT2G29980		AtFAD3, FAD3	fatty acid desaturase 3 (.1.2)		Potri.001G252900 [exp]	8.60	0.7641	FAD3.1
AT3G06145			unknown protein		Potri.010G030701 [exp]	10.09	0.7209
AT4G23820			Pectin lyase-like superfamily ...		Potri.003G139100 [exp]	11.83	0.8340
AT3G24480			Leucine-rich repeat (LRR) fami...		Potri.006G158814 [exp]	12.00	0.8241
AT1G24620			EF hand calcium-binding protei...		Potri.010G107100 [exp]	12.84	0.8028

Compare expression of checked genes

Potri.006G171300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.