Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57690 84 / 7e-21 ATDGK4 diacylglycerol kinase 4 (.1) AT2G18730 79 / 4e-19 ATDGK3 diacylglycerol kinase 3 (.1) AT4G30340 77 / 2e-18 ATDGK7 diacylglycerol kinase 7 (.1) AT2G20900 44 / 1e-06 DGK5, ATDGK5 diacylglycerol kinase 5 (.1.2.3.4) AT4G28130 41 / 8e-06 DGK6, ATDGK6 diacylglycerol kinase 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G174700 [exp] 104 / 3e-28 AT4G30340 670 / 0.0 diacylglycerol kinase 7 (.1) Potri.018G096700 [exp] 94 / 1e-24 AT2G18730 702 / 0.0 diacylglycerol kinase 3 (.1) Potri.001G408500 [exp] 47 / 1e-07 AT2G20900 695 / 0.0 diacylglycerol kinase 5 (.1.2.3.4) Potri.013G148500 [exp] 46 / 2e-07 AT2G20900 765 / 0.0 diacylglycerol kinase 5 (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019987 [exp] 97 / 2e-25 AT4G30340 713 / 0.0 diacylglycerol kinase 7 (.1) Lus10015514 [exp] 96 / 5e-25 AT4G30340 707 / 0.0 diacylglycerol kinase 7 (.1) Lus10006991 [exp] 92 / 1e-23 AT2G18730 677 / 0.0 diacylglycerol kinase 3 (.1) Lus10033732 [exp] 41 / 1e-05 AT2G20900 730 / 0.0 diacylglycerol kinase 5 (.1.2.3.4) Lus10031612 [exp] 41 / 1e-05 AT2G20900 719 / 0.0 diacylglycerol kinase 5 (.1.2.3.4) Lus10039747 [exp] 41 / 1e-05 AT2G20900 751 / 0.0 diacylglycerol kinase 5 (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00609 [poplar] [flax] DAGK_acc Diacylglycerol kinase accessory domain
Representative CDS sequence Show only first row Show all	>Potri.006G172400.1 pacid=42767967 polypeptide=Potri.006G172400.1.p locus=Potri.006G172400 ID=Potri.006G172400.1.v4.1 annot-version=v4.1 ATGCATGTTAAAAAAGTTAATTGCACAGAATGGGAGCAGATACCTGTTCCTAAAAGTGTAAGAGCAATTGTTGCTTTAAATCTTCACAATTATGGGAGTG GAAGAAATCCATGGGGTAGTCCTAAACGACAGTATTTGGAAAAGGTATCACACATCTGTCCTCCGAGTCTATTTTTAACACCAGTCAATTTTGCTCTTGT AACCCCTTAA
AA sequence Show only first row Show all	>Potri.006G172400.1 pacid=42767967 polypeptide=Potri.006G172400.1.p locus=Potri.006G172400 ID=Potri.006G172400.1.v4.1 annot-version=v4.1 MHVKKVNCTEWEQIPVPKSVRAIVALNLHNYGSGRNPWGSPKRQYLEKVSHICPPSLFLTPVNFALVTP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G57690		ATDGK4	diacylglycerol kinase 4 (.1)		Potri.006G172400 [exp]	0	1
AT1G21280			unknown protein		Potri.004G133001 [exp]	10.39	0.8754
AT2G39840		TOPP4	type one serine/threonine prot...		Potri.016G142700 [exp]	16.30	0.8493
AT3G54230		SUA	suppressor of abi3-5 (.1.2)		Potri.017G138401 [exp]	20.71	0.8732
AT3G08500	MYB	ATMYB83	myb domain protein 83 (.1)		Potri.009G061500 [exp]	24.49	0.8492
AT1G55810		UKL3	uridine kinase-like 3 (.1.2.3)		Potri.001G467800 [exp]	25.15	0.7657
					Potri.015G024900 [exp]	26.11	0.8447
					Potri.018G015000 [exp]	30.65	0.8411
AT2G38430			unknown protein		Potri.019G030050 [exp]	35.29	0.8433
AT1G21280			unknown protein		Potri.006G109250 [exp]	37.62	0.8439
AT2G25940		ALPHAVPE, ALPHA...	alpha-vacuolar processing enzy...		Potri.008G003400 [exp]	40.29	0.7670

Compare expression of checked genes

Potri.006G172400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.