Potri.006G175700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18670 90 / 2e-22 RING/U-box superfamily protein (.1)
AT4G30370 82 / 2e-19 RING/U-box superfamily protein (.1)
AT5G41400 66 / 1e-13 RING/U-box superfamily protein (.1)
AT2G42360 64 / 2e-12 RING/U-box superfamily protein (.1)
AT4G09100 61 / 4e-12 RING/U-box superfamily protein (.1)
AT3G16720 62 / 1e-11 ATL2 TOXICOS EN LEVADURA 2 (.1)
AT3G60220 62 / 2e-11 ATL4 TOXICOS EN LEVADURA 4 (.1)
AT2G42350 61 / 3e-11 RING/U-box superfamily protein (.1)
AT1G63840 59 / 5e-11 RING/U-box superfamily protein (.1)
AT2G44578 58 / 6e-11 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G098100 195 / 8e-64 AT2G18670 91 / 2e-23 RING/U-box superfamily protein (.1)
Potri.018G098000 170 / 4e-54 AT2G18670 87 / 6e-22 RING/U-box superfamily protein (.1)
Potri.001G235100 67 / 2e-13 AT1G04360 98 / 3e-24 RING/U-box superfamily protein (.1)
Potri.014G043200 62 / 3e-12 AT3G60966 76 / 4e-18 RING/U-box superfamily protein (.1)
Potri.010G010500 62 / 2e-11 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1)
Potri.008G165900 62 / 2e-11 AT1G04360 312 / 2e-104 RING/U-box superfamily protein (.1)
Potri.019G091400 61 / 5e-11 AT2G42360 143 / 9e-42 RING/U-box superfamily protein (.1)
Potri.005G113200 59 / 1e-10 AT2G17450 66 / 2e-13 RING-H2 finger A3A (.1)
Potri.006G201500 58 / 1e-10 AT2G35910 122 / 4e-35 RING/U-box superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019979 106 / 4e-29 AT2G18670 113 / 5e-32 RING/U-box superfamily protein (.1)
Lus10015506 95 / 7e-25 AT2G18670 102 / 2e-28 RING/U-box superfamily protein (.1)
Lus10008797 65 / 1e-12 AT5G40250 77 / 2e-16 RING/U-box superfamily protein (.1)
Lus10022223 65 / 1e-12 AT1G23980 81 / 2e-17 RING/U-box superfamily protein (.1)
Lus10042277 63 / 9e-12 AT3G16720 104 / 2e-26 TOXICOS EN LEVADURA 2 (.1)
Lus10016163 62 / 1e-11 AT2G27940 133 / 1e-38 RING/U-box superfamily protein (.1)
Lus10036466 60 / 1e-10 AT1G72200 186 / 6e-55 RING/U-box superfamily protein (.1)
Lus10041134 59 / 2e-10 AT1G72200 182 / 3e-54 RING/U-box superfamily protein (.1)
Lus10021524 59 / 2e-10 AT3G20395 170 / 7e-53 RING/U-box superfamily protein (.1)
Lus10027736 57 / 2e-10 AT4G17905 89 / 8e-22 RING/U-box superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.006G175700.2 pacid=42768968 polypeptide=Potri.006G175700.2.p locus=Potri.006G175700 ID=Potri.006G175700.2.v4.1 annot-version=v4.1
ATGAACAGCAAGCAAGCGCTCCTTTTAGTTAAGAAAAAACTTCTCCATTTGACAATTTCCTTTGCCTATATTCATTCAATTCCATCTGTAACCATGCCTC
CTCCTCACCGCCACCATGATCACCACCGTACACACGGTGGTGCAACACCACCGAAACCAAACCAAAAGCTTCTTTCCTTAATCCTCAAAACCATAATAAT
GACTGCAATAACCACCCTTTTTTTCCTATTCCTTGGTATTGCCGCCATCCTCCTCCTCATTGCCACCGCCGCACTCCACCGCCACTCGACTCCATCCTCC
AATTCCTCAAATGGGTTGTCTCTCAAAGATTTAAAGAAGCTCCCAATATTCAGATTTTCGACTCAGACAAGACCTGAAACGGGTGCTAATCAAACTTCAT
GTGTGGTTTGTCTTGAAGAGATAAAGCAAGGACAGTGGTGTAGAAACCTTGTTGGGTGTGGTCATGTGTTTCACAGGAAATGTGTGGATGCTTGGCTTGT
CAAGGTTTCTGCGTGCCCTATTTGCAGGACACAAGTTGAATTGGTTCATGGAGTAAAAGATAGTCCATTATGGGACTTTGATTGGACAAATGAATTGAGG
GTTTGGTAG
AA sequence
>Potri.006G175700.2 pacid=42768968 polypeptide=Potri.006G175700.2.p locus=Potri.006G175700 ID=Potri.006G175700.2.v4.1 annot-version=v4.1
MNSKQALLLVKKKLLHLTISFAYIHSIPSVTMPPPHRHHDHHRTHGGATPPKPNQKLLSLILKTIIMTAITTLFFLFLGIAAILLLIATAALHRHSTPSS
NSSNGLSLKDLKKLPIFRFSTQTRPETGANQTSCVVCLEEIKQGQWCRNLVGCGHVFHRKCVDAWLVKVSACPICRTQVELVHGVKDSPLWDFDWTNELR
VW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G18670 RING/U-box superfamily protein... Potri.006G175700 0 1
AT2G33730 P-loop containing nucleoside t... Potri.015G037200 8.30 0.7243
AT3G12050 Aha1 domain-containing protein... Potri.006G194400 13.03 0.6959
AT1G24267 Protein of unknown function (D... Potri.003G169200 16.43 0.6566
AT5G42560 Abscisic acid-responsive (TB2/... Potri.002G023500 18.70 0.6002
AT1G78770 APC6 anaphase promoting complex 6 (... Potri.001G389300 19.44 0.7076
AT1G18260 HRD3A, EBS5 EMS-mutagenized bri1 suppresso... Potri.012G046300 30.29 0.6362
AT1G67930 Golgi transport complex protei... Potri.005G203900 38.10 0.6847
Potri.006G055100 38.27 0.7177
AT4G30480 TPR1, AtTPR1 tetratricopeptide repeat 1, Te... Potri.018G100700 45.35 0.6852
AT4G17950 AT-hook AT hook motif DNA-binding fami... Potri.003G090900 48.50 0.6806

Potri.006G175700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.