Plant FIBer expression Database

Potri.006G176300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30380 166 / 3e-54 EXLB2 Barwin-related endoglucanase (.1)
AT2G18660 88 / 2e-23 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT2G45110 55 / 5e-10 ATHEXPBETA1.1, ATEXPB4 expansin B4 (.1)
AT2G40610 52 / 7e-09 ATHEXPALPHA1.11, ATEXP8, ATEXPA8 expansin A8 (.1)
AT1G65681 52 / 8e-09 EXPB6 beta expansin 6 (.1)
AT1G12560 49 / 1e-07 ATHEXPALPHA1.26, ATEXP7, ATEXPA7 expansin A7 (.1)
AT3G45960 47 / 5e-07 ATHEXPBETA2.3, ATEXPL3, ATEXLA3 expansin-like A3 (.1.2)
AT3G45970 46 / 1e-06 ATHEXPBETA2.1, ATEXPL1, ATEXLA1 EXPANSIN L1, expansin-like A1 (.1)
AT4G38400 46 / 1e-06 ATEXPL2, ATHEXPBETA2.2, EXPL2, ATEXLA2 EXPANSIN L2, expansin-like A2 (.1)
AT3G60570 45 / 2e-06 ATHEXPBETA1.3, ATEXPB5 expansin B5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G098200
[exp]
156 / 3e-50 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.018G101600
[exp]
116 / 1e-34 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.006G179300
[exp]
114 / 9e-34 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.003G218300
[exp]
96 / 2e-26 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.018G029100
[exp]
81 / 9e-21 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G252200
[exp]
76 / 1e-18 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.006G249500
[exp]
65 / 3e-14 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.018G031901
[exp]
62 / 2e-13 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.006G155000
[exp]
56 / 1e-10 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019978
[exp]
167 / 1e-54 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10031759
[exp]
96 / 4e-26 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1)
Lus10042435
[exp]
94 / 3e-25 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10026232
[exp]
90 / 1e-23 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10031760
[exp]
75 / 1e-18 AT4G30380 72 / 1e-17 Barwin-related endoglucanase (.1)
Lus10020130
[exp]
77 / 2e-18 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Lus10026930
[exp]
69 / 3e-15 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Lus10013118
[exp]
66 / 2e-14 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1)
Lus10026931
[exp]
67 / 3e-14 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
Lus10030078
[exp]
66 / 3e-14 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Potri.006G176300.2 pacid=42770572 polypeptide=Potri.006G176300.2.p locus=Potri.006G176300 ID=Potri.006G176300.2.v4.1 annot-version=v4.1
ATGGGAAAGAGGATTTTGATCGCGATGGGGATTTTTGCAAGCCTTCTCTCTGTAGCTGTTGCTATACCGGGAATCGCTACTTTCTACACAAACTATGTTC
CATCTGCCTGCTATGGCAACAAAAGCTTTGGTGTTATGATAGCAGCAGCAAATGATAGTTTATGGAACAACGGGGCTGCTTGTGGAAAAGTGTTCCATGT
TACATGTAAAGGTCCCAGGAATCCAGTACCACATCCATGCACAGGCAAGACTGTAACTGTGAAGGTTGTGGATCACTGTCCTGGATGTCCATCGACGCTT
GACCTCTCCAAGGAAGCCTTCACTCAAATCGCTAACCCTGTTGCCGGCATAATTAACATCGACTACATTCAGTAA
AA sequence
>Potri.006G176300.2 pacid=42770572 polypeptide=Potri.006G176300.2.p locus=Potri.006G176300 ID=Potri.006G176300.2.v4.1 annot-version=v4.1
MGKRILIAMGIFASLLSVAVAIPGIATFYTNYVPSACYGNKSFGVMIAAANDSLWNNGAACGKVFHVTCKGPRNPVPHPCTGKTVTVKVVDHCPGCPSTL
DLSKEAFTQIANPVAGIINIDYIQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G30380 EXLB2 Barwin-related endoglucanase (... Potri.006G176300
[exp]
0 1

Potri.006G176300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.