Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30480 275 / 8e-93 TPR1, AtTPR1 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) AT3G58620 68 / 1e-12 TTL4 tetratricopetide-repeat thioredoxin-like 4 (.1) AT3G25230 64 / 2e-11 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) AT1G53300 61 / 2e-10 TTL1 tetratricopetide-repeat thioredoxin-like 1 (.1) AT2G42580 61 / 2e-10 VIT, TTL3 VHI-INTERACTING TPR CONTAINING PROTEIN, tetratricopetide-repeat thioredoxin-like 3 (.1) AT4G32070 60 / 5e-10 Phox4 Phox4, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) AT4G12400 59 / 9e-10 Hop3 Hop3, stress-inducible protein, putative (.1.2) AT5G65160 59 / 1e-09 TPR14 tetratricopeptide repeat 14, tetratricopeptide repeat (TPR)-containing protein (.1) AT5G21990 57 / 4e-09 OEP61, TPR7 tetratricopeptide repeat 7, outer envelope protein 61, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G14950 57 / 6e-09 TTL2 tetratricopetide-repeat thioredoxin-like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G100700 [exp] 338 / 9e-118 AT4G30480 303 / 8e-104 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Potri.011G021000 [exp] 69 / 4e-13 AT1G62390 885 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) Potri.006G033400 [exp] 66 / 7e-12 AT5G48570 596 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.011G111500 [exp] 64 / 3e-11 AT1G53300 707 / 0.0 tetratricopetide-repeat thioredoxin-like 1 (.1) Potri.002G248300 [exp] 62 / 1e-10 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.018G121100 [exp] 61 / 3e-10 AT2G25290 737 / 0.0 Phox1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein Potri.002G117200 [exp] 61 / 3e-10 AT5G48570 553 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.005G177400 [exp] 60 / 3e-10 AT4G08320 406 / 1e-139 tetratricopeptide repeat 8, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.014G149400 [exp] 60 / 5e-10 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035117 [exp] 256 / 2e-85 AT4G30480 291 / 3e-99 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Lus10028919 [exp] 68 / 1e-12 AT1G62740 890 / 0.0 Hop2, stress-inducible protein, putative (.1) Lus10004336 [exp] 66 / 9e-12 AT1G62740 873 / 0.0 Hop2, stress-inducible protein, putative (.1) Lus10025888 [exp] 65 / 1e-11 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10038216 [exp] 63 / 4e-11 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10002338 [exp] 63 / 7e-11 AT3G25230 874 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10003171 [exp] 61 / 2e-10 AT3G25230 871 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10038106 [exp] 59 / 1e-09 AT2G25290 655 / 0.0 Phox1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein Lus10021502 [exp] 59 / 1e-09 AT3G54010 847 / 0.0 PASTICCINO 1, FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1.2) Lus10008035 [exp] 59 / 1e-09 AT2G25290 667 / 0.0 Phox1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF13414 [poplar] [flax] TPR_11 TPR repeat
Representative CDS sequence Show only first row Show all	>Potri.006G178900.1 pacid=42767417 polypeptide=Potri.006G178900.1.p locus=Potri.006G178900 ID=Potri.006G178900.1.v4.1 annot-version=v4.1 ATGGTGATGATCCAGCCAGAAGAAGAAAACGAAGAGACCGTACTACAAAATCTACCAAAGCCTCAAGCAACAGCTTCAACATCAAAAACCACCACCAGCG ACACCACCACAACAAAAGAGAACGGAAGCGACTCCGATGGGTTTGAAACGGCAAGCGAGCGCGGAGTCAGCGACAACGAAGAAGAAGATATTGTCAATAA GGGAATCAACCCCGAAAACAGCGCTGATGATCAACAACAACAACAACATACTCAAAACGATGACGAATTGATTCAGAGAGGTGTAGAAGAAGGAAATGAA GCAAAATTGGAAGGCAATAGATTGTTTGGGAACGGGCAGTATGAGGAGGCATTACTACAGTATGAACTTGCTTTACAAGTTGCCCCACAGGACGTGCCGT CATCCGTCGAGTTGCGTTCCATTTGCCATTTCAATCGTGGCGTTTGCTTCTTGAAATTGGGAAAATACGAGGACACAATCAAGGAATGCTCAAGAGCGTT AGAATTGAATCCTTCTTACACGAAAGCTCTTGTTAGAAGAGGAGAGGCTCATGAAAAGCTCGAGCATTTTGAGGAGGCTATTGCTGATATGAAAAAAACC TTGGAATTCGATCCTTCAAATGACCAAGCAAAGAAAACCATTCGCCGCTTGGAGCCACTTGCTGCAGAAAAGCGAGAAAAGATGAAGGAAGAGATGATTG GAAAGCTGAAAGAGATGGGAAACTCTTTGCTAGGCCGCTTTGGCATGAGCATTGACAACTTCAAAGCTGTTCAAGATCCGAATACCGGTTCCTATTCTAT TTCATTCCAACGTTAG
AA sequence Show only first row Show all	>Potri.006G178900.1 pacid=42767417 polypeptide=Potri.006G178900.1.p locus=Potri.006G178900 ID=Potri.006G178900.1.v4.1 annot-version=v4.1 MVMIQPEEENEETVLQNLPKPQATASTSKTTTSDTTTTKENGSDSDGFETASERGVSDNEEEDIVNKGINPENSADDQQQQQHTQNDDELIQRGVEEGNE AKLEGNRLFGNGQYEEALLQYELALQVAPQDVPSSVELRSICHFNRGVCFLKLGKYEDTIKECSRALELNPSYTKALVRRGEAHEKLEHFEEAIADMKKT LEFDPSNDQAKKTIRRLEPLAAEKREKMKEEMIGKLKEMGNSLLGRFGMSIDNFKAVQDPNTGSYSISFQR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G30480		TPR1, AtTPR1	tetratricopeptide repeat 1, Te...		Potri.006G178900 [exp]	0	1
					Potri.014G059200 [exp]	5.91	0.8889
AT1G26800			RING/U-box superfamily protein...		Potri.010G168300 [exp]	7.07	0.9100
AT4G30480		TPR1, AtTPR1	tetratricopeptide repeat 1, Te...		Potri.018G100700 [exp]	7.48	0.8471
AT5G43950			Plant protein of unknown funct...		Potri.014G193100 [exp]	8.48	0.8223
AT5G28460			Pentatricopeptide repeat (PPR)...		Potri.014G090400 [exp]	12.24	0.8967
AT2G47620		CHB1, ATSWI3A	SWITCH/sucrose nonfermenting 3...		Potri.015G100400 [exp]	12.32	0.8339
AT1G79510			Uncharacterized conserved prot...		Potri.008G083400 [exp]	13.26	0.8312
AT5G04010			F-box family protein (.1)		Potri.004G076800 [exp]	14.07	0.8782
AT2G34930			disease resistance family prot...		Potri.015G024500 [exp]	14.96	0.8667
AT5G63840		PSL5, RSW3	RADIAL SWELLING 3, PRIORITY IN...		Potri.005G069000 [exp]	15.29	0.8616

Compare expression of checked genes

Potri.006G178900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.