Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18660 117 / 1e-34 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1) AT4G30380 97 / 6e-27 EXLB2 Barwin-related endoglucanase (.1) AT5G39260 48 / 3e-07 ATHEXPALPHA1.20, ATEXP21, ATEXPA21 EXPANSIN 21, expansin A21 (.1) AT5G56320 45 / 2e-06 ATHEXPALPHA1.5, ATEXP14, ATEXPA14 EXPANSIN 14, expansin A14 (.1) AT1G26770 44 / 8e-06 ATHEXPALPHA1.1, AT-EXP10, ATEXP10, ATEXPA10 ARABIDOPSIS THALIANA EXPANSIN ALPHA 1.1, ARABIDOPSIS THALIANA EXPANSIN 10, expansin A10 (.1.2) AT5G39310 43 / 1e-05 ATHEXPALPHA1.19, ATEXP24, ATEXPA24 EXPANSIN 24, expansin A24 (.1) AT1G20190 42 / 2e-05 ATHEXPALPHA1.14, ATEXP11, ATEXPA11 EXPANSIN 11, expansin 11 (.1) AT5G39290 42 / 3e-05 ATHEXPALPHA1.16, ATEXP26 EXPANSIN 26, expansin A26 (.1) AT5G39270 42 / 3e-05 ATHEXPALPHA1.15, ATEXP22, ATEXPA22 EXPANSIN 22, expansin A22 (.1) AT5G39280 41 / 9e-05 ATEXP23, ATHEXPALPHA1.17, ATEXPA23 EXPANSIN 23, expansin A23 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G101600 [exp] 227 / 2e-78 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1) Potri.018G098200 [exp] 125 / 7e-38 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1) Potri.006G176300 [exp] 114 / 1e-33 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1) Potri.003G218300 [exp] 112 / 1e-32 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1) Potri.006G252200 [exp] 106 / 2e-30 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1) Potri.018G029100 [exp] 101 / 1e-28 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1) Potri.018G031901 [exp] 72 / 4e-17 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1) Potri.006G249500 [exp] 66 / 2e-14 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1) Potri.006G155000 [exp] 63 / 3e-13 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031759 [exp] 125 / 2e-37 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1) Lus10019978 [exp] 109 / 9e-32 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1) Lus10042435 [exp] 102 / 2e-28 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1) Lus10030078 [exp] 93 / 9e-25 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1) Lus10031760 [exp] 83 / 6e-22 AT4G30380 72 / 1e-17 Barwin-related endoglucanase (.1) Lus10026232 [exp] 83 / 7e-21 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1) Lus10026930 [exp] 77 / 5e-18 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1) Lus10020130 [exp] 75 / 2e-17 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1) Lus10020131 [exp] 68 / 4e-15 AT2G18660 59 / 2e-11 plant natriuretic peptide A (.1) Lus10026932 [exp] 66 / 3e-14 AT2G18660 58 / 3e-11 plant natriuretic peptide A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0199 [poplar] [flax] DPBB PF03330 [poplar] [flax] DPBB_1 Lytic transglycolase
Representative CDS sequence Show only first row Show all	>Potri.006G179300.2 pacid=42769163 polypeptide=Potri.006G179300.2.p locus=Potri.006G179300 ID=Potri.006G179300.2.v4.1 annot-version=v4.1 ATGGGTTATAAGATTGAATCAGTTTTTATAATGGTAGGCATTGTATCATGCCTTATCTCCGTTGCGCATGCTGCACAAGGAAATGCCGTTTTCTATGATC CTCCTTATACTCCCTCTAAGTGTTACGGAAACAGGAACGATGGAGTTATGGTTGCTGGGGTGAGTGATGCTCTGTGGAATGGTGGAGCAGCATGCGGGAG AAAATACAGAGTGTCGTGCATACGAGGTGCAAATGAAGCTCCAAAACCATGCAAACAAGGTAGTGTCGTTGTAACAGTTGTCGATTATTGTAGAAGAGGA TGTAATGGAGTCATCAATCTTTCGAAAGATGCTTTCTCCCGGATCGCTGATCCTAATGCTGGCAAAGTCGTAATTCAATACGACCAGGTTTGA
AA sequence Show only first row Show all	>Potri.006G179300.2 pacid=42769163 polypeptide=Potri.006G179300.2.p locus=Potri.006G179300 ID=Potri.006G179300.2.v4.1 annot-version=v4.1 MGYKIESVFIMVGIVSCLISVAHAAQGNAVFYDPPYTPSKCYGNRNDGVMVAGVSDALWNGGAACGRKYRVSCIRGANEAPKPCKQGSVVVTVVDYCRRG CNGVINLSKDAFSRIADPNAGKVVIQYDQV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G18660		AtPNP-A, PNP-A,...	plant natriuretic peptide A (....		Potri.006G179300 [exp]	0	1
AT5G24090		ATCHIA	chitinase A (.1)		Potri.002G165700 [exp]	2.23	0.9892	CHI3.11
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Potri.016G057400 [exp]	2.44	0.9919
AT4G30460			glycine-rich protein (.1)		Potri.006G178200 [exp]	3.46	0.9911
AT3G62040			Haloacid dehalogenase-like hyd...		Potri.002G185300 [exp]	4.89	0.9812
AT3G28960			Transmembrane amino acid trans...		Potri.008G086500 [exp]	5.19	0.9732
AT3G56630		CYP94D2	"cytochrome P450, family 94, s...		Potri.016G031850 [exp]	6.00	0.9639
AT1G18350		ATMKK7, BUD1	MAP KINASE KINASE7, BUSHY AND ...		Potri.010G049500 [exp]	6.00	0.9457
AT5G10770			Eukaryotic aspartyl protease f...		Potri.018G014900 [exp]	7.07	0.9726
					Potri.008G028050 [exp]	8.00	0.9467
AT5G10770			Eukaryotic aspartyl protease f...		Potri.018G014700 [exp]	8.06	0.9613

Compare expression of checked genes

Potri.006G179300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.