Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	NAC140
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44350 81 / 7e-18 NAC ANAC061 NAC domain containing protein 61 (.1.2) AT1G01720 79 / 7e-17 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT3G15510 79 / 2e-16 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT5G08790 77 / 3e-16 NAC ATAF2, ANAC081 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT3G10480 78 / 4e-16 NAC ANAC050 NAC domain containing protein 50 (.1.2.3) AT2G17040 77 / 4e-16 NAC ANAC036 NAC domain containing protein 36 (.1) AT4G27410 77 / 5e-16 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT1G61110 76 / 1e-15 NAC ANAC025 NAC domain containing protein 25 (.1) AT5G09330 76 / 2e-15 NAC VNI1, ANAC082 VND-interacting 1, NAC domain containing protein 82 (.1.2.3.4) AT1G52890 75 / 2e-15 NAC ANAC019 NAC domain containing protein 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G046700 [exp] 87 / 2e-19 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.014G107500 [exp] 87 / 5e-19 AT4G35580 143 / 3e-37 NAC transcription factor-like 9 (.1.2.3) Potri.004G038000 [exp] 86 / 5e-19 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.007G099400 [exp] 83 / 4e-18 AT1G01720 366 / 6e-128 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.001G404400 [exp] 82 / 1e-17 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.005G069500 [exp] 81 / 2e-17 AT1G01720 357 / 3e-124 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.004G049500 [exp] 81 / 3e-17 AT1G61110 232 / 4e-74 NAC domain containing protein 25 (.1) Potri.002G081000 [exp] 80 / 4e-17 AT1G01720 416 / 5e-148 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.001G404100 [exp] 80 / 5e-17 AT4G27410 370 / 8e-129 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026496 [exp] 87 / 1e-19 AT1G61110 244 / 6e-79 NAC domain containing protein 25 (.1) Lus10019926 [exp] 86 / 5e-19 AT1G61110 243 / 4e-78 NAC domain containing protein 25 (.1) Lus10033493 [exp] 83 / 4e-18 AT5G08790 315 / 4e-108 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10020883 [exp] 82 / 5e-18 AT5G08790 320 / 6e-110 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10036117 [exp] 83 / 7e-18 AT3G15510 241 / 2e-78 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10015076 [exp] 83 / 7e-18 AT1G61110 247 / 5e-80 NAC domain containing protein 25 (.1) Lus10007410 [exp] 82 / 9e-18 AT3G15510 241 / 1e-78 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10023179 [exp] 82 / 1e-17 AT1G61110 248 / 2e-80 NAC domain containing protein 25 (.1) Lus10032657 [exp] 81 / 2e-17 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10027357 [exp] 82 / 3e-17 AT3G04070 172 / 3e-50 NAC domain containing protein 47 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.006G179800.1 pacid=42768864 polypeptide=Potri.006G179800.1.p locus=Potri.006G179800 ID=Potri.006G179800.1.v4.1 annot-version=v4.1 ATGAGCACACCAATCTCAGAAACCTCAGAGAAGAACTGGGATGTAGATCGTGCGATGCAAAGTGATGGTGAACCGAGGCGTCACGATCAAGTAAGGGAAG CGTTTAGAAGCTTATCTACATCAGCCAATTGGATGGATTGGTTCAAGTTTGGACCAGTTGGTTGGAGATTTAACCCTAGTGACATAGAATTGCTTGATTA TTATTTACGTGCAAGAAAATATGGTGGTGGTGCAATTTGTGAAGGTATTTTTGGTGACTTTGATCTCTATAAATATGATCCTCAAAACTTACCACAAGAT AAAGTGCATCGCCATTGTAATGGCAGGATGTATATTTTTACTCCTATTTACAAACTCCATATAAATGGAGCGAGGAAGGGTAAACGAAACACCCCGAATG GACATTGGAAGATGAATTCATCTCCCATTCCCATTATCGAAAATAACGATGGACAAACAATTGGTACCAGGTCATCTCTTGTCTTCTTCGATAAGGATAA AAGGAAGACACGTTGGCTTATGTATGAATTCAGGCTTGTAGATCCTCCCACACAAACCATTGAAAATGAAGGCATGTTGGACCACTGTGTGCTAGCAGTG GTTTATAGGTCCAAAGAGGATAGACTGGATACTGCTACCAATAAAAACAGATGGTCACATGATTATGTGGCACACACTATAGGTTTTGATGAATTTAACT CAGAACCAAAACGTTGCCACGATCAAGTTCTGTCCGATAACAAGGAAAACCATTCCATGGAGCCGAGCCATAGAAAGCGTAAATATGCTCAAGATATTGG TGGGACTTCAACTTCAAATAGTAATTCAATCACAAATTTTTCCTAG
AA sequence Show only first row Show all	>Potri.006G179800.1 pacid=42768864 polypeptide=Potri.006G179800.1.p locus=Potri.006G179800 ID=Potri.006G179800.1.v4.1 annot-version=v4.1 MSTPISETSEKNWDVDRAMQSDGEPRRHDQVREAFRSLSTSANWMDWFKFGPVGWRFNPSDIELLDYYLRARKYGGGAICEGIFGDFDLYKYDPQNLPQD KVHRHCNGRMYIFTPIYKLHINGARKGKRNTPNGHWKMNSSPIPIIENNDGQTIGTRSSLVFFDKDKRKTRWLMYEFRLVDPPTQTIENEGMLDHCVLAV VYRSKEDRLDTATNKNRWSHDYVAHTIGFDEFNSEPKRCHDQVLSDNKENHSMEPSHRKRKYAQDIGGTSTSNSNSITNFS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G44350	NAC	ANAC061	NAC domain containing protein ...		Potri.006G179800 [exp]	0	1	NAC140
					Potri.003G096450 [exp]	1.73	1.0000
					Potri.005G122150 [exp]	2.64	1.0000
					Potri.008G073450 [exp]	3.00	1.0000
AT5G15180			Peroxidase superfamily protein...		Potri.012G006900 [exp]	3.46	1.0000
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Potri.016G005600 [exp]	4.00	1.0000
					Potri.008G131750 [exp]	4.47	1.0000
					Potri.003G157850 [exp]	4.89	0.9996
AT4G26200		ACS7, ATACS7	1-amino-cyclopropane-1-carboxy...		Potri.006G149600 [exp]	5.29	0.9936	ACS6,ACS3.1
AT1G27660	bHLH	bHLH110	basic helix-loop-helix (bHLH) ...		Potri.008G052000 [exp]	7.34	0.9941
					Potri.015G034150 [exp]	7.74	1.0000

Compare expression of checked genes

Potri.006G179800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.