Potri.006G180700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26390 59 / 2e-11 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G102900 222 / 6e-75 AT5G39010 / unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013380 72 / 4e-16 ND 41 / 8e-05
Lus10013379 59 / 2e-11 ND 42 / 6e-05
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0154 C2 PF00168 C2 C2 domain
Representative CDS sequence
>Potri.006G180700.1 pacid=42768825 polypeptide=Potri.006G180700.1.p locus=Potri.006G180700 ID=Potri.006G180700.1.v4.1 annot-version=v4.1
ATGAAGACGATGAACAGAAGAAGAATGTTTACAAGGAATAAGAGAATAGCCATAGAGAAAGACTATGATATTGATTTACTTTTGAGCATCGACCATGCAG
AGGGCTTAGACAACCCTAGCACCTATCCTTCAGTAACCACCAGGGATTACCGTGTTGTATTTTGGGTTCACCCAGATGATCAACTTGCAACATCTCGCGA
TCTAGGCTCTCCAGATCCTGTATGGAACCAGAAGTGTCGTATGAAGTTAGACAAGTCCAGGGATTGCAAGTTTTTGTATGTTGAGGTGCTTAGGTATGGA
TCCTCCTCTGAGAGTAACCCAGGAACCTCTAATGGCATAAGCTTGGTGGGTAGGGCTCAGATACCTCTACCGAACTTGTCAAGTAAAACTGATGGCCGCT
ATGGACTTGTGAGGCCTAAAGAGGATGGATATAAGGCTGAGGGACACATTACTCTGTCAATGAAATTGGTGAAGATAGATATAATATAA
AA sequence
>Potri.006G180700.1 pacid=42768825 polypeptide=Potri.006G180700.1.p locus=Potri.006G180700 ID=Potri.006G180700.1.v4.1 annot-version=v4.1
MKTMNRRRMFTRNKRIAIEKDYDIDLLLSIDHAEGLDNPSTYPSVTTRDYRVVFWVHPDDQLATSRDLGSPDPVWNQKCRMKLDKSRDCKFLYVEVLRYG
SSSESNPGTSNGISLVGRAQIPLPNLSSKTDGRYGLVRPKEDGYKAEGHITLSMKLVKIDII

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G26390 unknown protein Potri.006G180700 0 1
AT5G08780 winged-helix DNA-binding trans... Potri.005G069700 3.87 0.6919
AT5G17580 Phototropic-responsive NPH3 fa... Potri.013G073700 56.49 0.5324
AT4G14480 Protein kinase superfamily pro... Potri.004G194700 81.05 0.5662
AT1G27090 glycine-rich protein (.1) Potri.008G194200 140.49 0.5565
Potri.008G009201 161.54 0.5431
AT1G62930 RPF3 RNA processing factor 3, Tetra... Potri.013G034300 201.52 0.5348

Potri.006G180700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.