Plant FIBer expression Database

Potri.006G181400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G57860 151 / 2e-49 Ubiquitin-like superfamily protein (.1.2.3.4)
AT4G05230 37 / 0.0007 Ubiquitin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036598
[exp]
186 / 1e-62 AT5G57860 149 / 2e-48 Ubiquitin-like superfamily protein (.1.2.3.4)
Lus10035816
[exp]
184 / 4e-62 AT5G57860 147 / 1e-47 Ubiquitin-like superfamily protein (.1.2.3.4)
Lus10034563
[exp]
40 / 0.0001 AT5G42220 444 / 3e-148 Ubiquitin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
Representative CDS sequence
>Potri.006G181400.1 pacid=42767242 polypeptide=Potri.006G181400.1.p locus=Potri.006G181400 ID=Potri.006G181400.1.v4.1 annot-version=v4.1
ATGGCTATGTACATCCGGGTTAAGCGTAACAAGACAACTTACTTTATCCAGTGTGATCCAACTGAGAAAACTCTGGAGATTAAGCAGAAATTAAATGTCC
TTATTGATCAACCAGTTAATGATCAGCGGTTGATCTTAGTGGGAACAGGGGAAGTGTTGGAGGATTCAAAGTCATTGGCAGAGCAGAAGGTGGAAAATGA
TGCTGTCGTGGCACTAACCTTGAGAAAAGATGACAATGAGTTTGAGGATGTCAGCATTGTGCGGCCTGATGATTTTTACCAGTCTCGTGATGCAGATGGT
ACAAATTGGTGA
AA sequence
>Potri.006G181400.1 pacid=42767242 polypeptide=Potri.006G181400.1.p locus=Potri.006G181400 ID=Potri.006G181400.1.v4.1 annot-version=v4.1
MAMYIRVKRNKTTYFIQCDPTEKTLEIKQKLNVLIDQPVNDQRLILVGTGEVLEDSKSLAEQKVENDAVVALTLRKDDNEFEDVSIVRPDDFYQSRDADG
TNW

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G57860 Ubiquitin-like superfamily pro... Potri.006G181400
[exp]
0 1
AT4G32930 unknown protein Potri.006G233500
[exp]
2.44 0.7874
AT5G58060 ATYKT61, ATGP1,... SNARE-like superfamily protein... Potri.018G110700
[exp]
3.16 0.8060
AT1G63800 UBC5 ubiquitin-conjugating enzyme 5... Potri.014G086600
[exp]
5.29 0.7962 Pt-UBC4.2
AT3G03070 NADH-ubiquinone oxidoreductase... Potri.013G082100
[exp]
7.14 0.8125
AT5G16450 Ribonuclease E inhibitor RraA/... Potri.019G053800
[exp]
9.16 0.7484
AT3G52560 MMZ4 ,UEV1D ,UE... MMS2 ZWEI HOMOLOGUE 4, ubiquit... Potri.006G205700
[exp]
12.36 0.7223
AT4G39220 ATRER1A Rer1 family protein (.1) Potri.009G118500
[exp]
13.41 0.7523
AT5G55290 ATPase, V0 complex, subunit E ... Potri.011G092600
[exp]
13.74 0.8014
AT4G34720 ATVHA-C1, AVA-P... VACUOLAR H+-PUMPING ATPASE C1,... Potri.009G125000
[exp]
20.73 0.7918 Pt-AVAP5.2
AT5G53300 UBC10 ubiquitin-conjugating enzyme 1... Potri.012G033000
[exp]
23.32 0.7576 UBC9.1

Potri.006G181400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.