RPL16.2 (Potri.006G181600) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol RPL16.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42740 320 / 1e-113 RPL16A ribosomal protein large subunit 16A (.1)
AT5G45775 320 / 2e-113 Ribosomal L5P family protein (.1.2)
AT4G18730 320 / 2e-113 RPL16B ribosomal protein L16B (.1)
AT3G58700 320 / 2e-113 Ribosomal L5P family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G068900 329 / 5e-117 AT5G45775 320 / 1e-113 Ribosomal L5P family protein (.1.2)
Potri.006G181501 329 / 5e-117 AT5G45775 320 / 1e-113 Ribosomal L5P family protein (.1.2)
Potri.011G069200 327 / 2e-116 AT2G42740 318 / 1e-112 ribosomal protein large subunit 16A (.1)
Potri.002G109701 108 / 2e-31 AT2G42740 127 / 5e-39 ribosomal protein large subunit 16A (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033607 325 / 2e-115 AT2G42740 362 / 7e-130 ribosomal protein large subunit 16A (.1)
Lus10020715 319 / 4e-113 AT2G42740 359 / 5e-129 ribosomal protein large subunit 16A (.1)
Lus10029824 307 / 3e-108 AT2G42740 347 / 5e-124 ribosomal protein large subunit 16A (.1)
Lus10017648 306 / 3e-108 AT2G42740 343 / 1e-122 ribosomal protein large subunit 16A (.1)
Lus10007915 52 / 4e-08 AT4G01310 364 / 3e-128 Ribosomal L5P family protein (.1)
Lus10036390 52 / 6e-08 AT4G01310 349 / 1e-121 Ribosomal L5P family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0652 S24e_L23_L15e PF00281 Ribosomal_L5 Ribosomal protein L5
CL0652 PF00673 Ribosomal_L5_C ribosomal L5P family C-terminus
Representative CDS sequence
>Potri.006G181600.1 pacid=42768068 polypeptide=Potri.006G181600.1.p locus=Potri.006G181600 ID=Potri.006G181600.1.v4.1 annot-version=v4.1
ATGGCTTCAGAGAAGAAACTATCGAACCCAATGAGAGAGATCAAGGTCCAGAAGTTGGTCCTCAACATCTCTGTCGGCGAGAGTGGTGATCGCCTCACCC
GTGCCGCCAAGGTCCTTGAACAGCTTAGTGGCCAAACACCAGTCTTCTCGAAGGCTAGGTATACTGTGAGATCTTTTGGGATCAGGCGTAACGAGAAGAT
TGCTTGCTATGTCACTGTGAGGGGAGACAAGGCTATGCAGTTGCTGGAAAGTGGGTTGAAGGTGAAGGAGTATGAGCTTTTGAGGAGGAACTTCAGTGAT
ACTGGTTGCTTCGGATTCGGTATTCAGGAGCACATTGATCTTGGCATCAAGTACGACCCTTCTACAGGTATTTATGGCATGGACTTCTACGTTGTTTTGG
AACGTCCTGGATACCGTGTTGGCCGTCGTCGTAGGTGCAAGAGTCGTGTTGGAATTCACCAGAGAGTTACAAAGGACGACGCAATGAAGTGGTTCCAAGT
CAAGTATGAAGGAGTCATACTTAACAAGTCCCAAAATATTTGA
AA sequence
>Potri.006G181600.1 pacid=42768068 polypeptide=Potri.006G181600.1.p locus=Potri.006G181600 ID=Potri.006G181600.1.v4.1 annot-version=v4.1
MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSD
TGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTKDDAMKWFQVKYEGVILNKSQNI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G45775 Ribosomal L5P family protein (... Potri.006G181600 0 1 RPL16.2
AT2G39390 Ribosomal L29 family protein ... Potri.010G212300 2.00 0.9560 RPL35.2
AT5G09500 Ribosomal protein S19 family p... Potri.002G043200 4.00 0.9528
AT1G57860 Translation protein SH3-like f... Potri.006G195400 5.65 0.9423
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.011G148700 6.48 0.9389 RPL9.5
AT4G25740 RNA binding Plectin/S10 domain... Potri.017G146700 10.48 0.9409 RPS10.3
AT2G19730 Ribosomal L28e protein family ... Potri.003G045500 10.95 0.9432
AT4G36130 Ribosomal protein L2 family (.... Potri.007G013101 11.66 0.9207
AT1G22450 ATCOX6B2, COX6B CYTOCHROME C OXIDASE 6B2, cyto... Potri.002G100000 12.24 0.8369
AT3G53740 Ribosomal protein L36e family ... Potri.012G142600 13.49 0.9277
AT4G10450 Ribosomal protein L6 family (.... Potri.011G147700 14.73 0.9340 Pt-RPL9.4

Potri.006G181600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.