Plant FIBer expression Database

Potri.006G183333 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.006G183333.1 pacid=42767220 polypeptide=Potri.006G183333.1.p locus=Potri.006G183333 ID=Potri.006G183333.1.v4.1 annot-version=v4.1
ATGAGCGGTGGGCTGGGATGGGAAATAAGGGTCTTGGCAAGTGGGCACTGGATCGTTGAAAAAGATTGCTTTATTTCTTTAGGCATGACTTCAACCATCA
CCTCCCAACGGCTACGGCGCCGGACTTTGACCAAAATATATAATCTTGCACTTGGACAATGCCAGTTTTCAATTCGAGCAGTTGTGCTTGAAGAGCTATT
TATATCGTTTTTTTTTTTTTTAATTTGTGTACAGCCGACACTTTTTTTCGTACATTTTTATGCAGAGATCATTGGTTTAAATCCCCCGCGTCGTCGCTGT
GTGTTCAATCAAAATTTCTTGGAATATATATATATATATATATATATAATTTTTAAGCATTTTCATTTTAAAAATTCTCCAATTGATATTTTACTTAACC
TGAATTTTAAATTAAATTACGTAAAACTTATAATGATGTGA
AA sequence
>Potri.006G183333.1 pacid=42767220 polypeptide=Potri.006G183333.1.p locus=Potri.006G183333 ID=Potri.006G183333.1.v4.1 annot-version=v4.1
MSGGLGWEIRVLASGHWIVEKDCFISLGMTSTITSQRLRRRTLTKIYNLALGQCQFSIRAVVLEELFISFFFFLICVQPTLFFVHFYAEIIGLNPPRRRC
VFNQNFLEYIYIYIYIIFKHFHFKNSPIDILLNLNFKLNYVKLIMM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.006G183333
[exp]
0 1
Potri.019G014366
[exp]
2.82 0.8009
AT4G33590 unknown protein Potri.007G112500
[exp]
6.00 0.7727
AT1G30870 Peroxidase superfamily protein... Potri.003G156100
[exp]
12.00 0.7264
AT3G63420 AGG1, ATAGG1 Ggamma-subunit 1 (.1.2) Potri.005G216100
[exp]
16.52 0.8086 Pt-AGG1.1
AT1G24260 MADS AGL9, SEP3 SEPALLATA3, AGAMOUS-like 9, K-... Potri.001G058400
[exp]
29.59 0.7852
AT2G48020 Major facilitator superfamily ... Potri.014G136532
[exp]
44.27 0.7549
AT2G31180 MYB ATMYB14, Myb14a... ARABIDOPSIS THALIANA MYB DOMAI... Potri.011G040400
[exp]
45.16 0.7183
AT1G08510 FATB fatty acyl-ACP thioesterases B... Potri.010G117400
[exp]
47.64 0.7440
AT5G63860 UVR8 UVB-RESISTANCE 8, Regulator of... Potri.005G068801
[exp]
63.87 0.6715
AT4G27420 ABCG9 ATP-binding cassette G9, ABC-2... Potri.001G404000
[exp]
64.53 0.7209

Potri.006G183333 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.