Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30996 198 / 1e-65 NKS1 NA\(+\)- AND K\(+\)-SENSITIVE 1, Protein of unknown function (DUF1068) (.1) AT2G24290 188 / 1e-61 Protein of unknown function (DUF1068) (.1) AT2G32580 86 / 4e-21 Protein of unknown function (DUF1068) (.1), Protein of unknown function (DUF1068) (.2) AT1G05070 80 / 4e-19 Protein of unknown function (DUF1068) (.1) AT4G04360 62 / 4e-12 Protein of unknown function (DUF1068) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G111100 [exp] 252 / 7e-87 AT4G30996 208 / 2e-69 NA\(+\)- AND K\(+\)-SENSITIVE 1, Protein of unknown function (DUF1068) (.1) Potri.014G155600 [exp] 88 / 4e-22 AT2G32580 245 / 1e-83 Protein of unknown function (DUF1068) (.1), Protein of unknown function (DUF1068) (.2) Potri.002G227100 [exp] 84 / 2e-20 AT2G32580 218 / 6e-73 Protein of unknown function (DUF1068) (.1), Protein of unknown function (DUF1068) (.2) Potri.004G006500 [exp] 80 / 8e-19 AT2G32580 206 / 6e-68 Protein of unknown function (DUF1068) (.1), Protein of unknown function (DUF1068) (.2) Potri.005G038000 [exp] 67 / 3e-14 AT1G05070 110 / 7e-31 Protein of unknown function (DUF1068) (.1) Potri.013G026900 [exp] 67 / 6e-14 AT2G24290 114 / 2e-32 Protein of unknown function (DUF1068) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019053 [exp] 226 / 1e-76 AT2G24290 259 / 1e-89 Protein of unknown function (DUF1068) (.1) Lus10036299 [exp] 224 / 2e-75 AT2G24290 257 / 1e-88 Protein of unknown function (DUF1068) (.1) Lus10035288 [exp] 81 / 4e-19 AT1G05070 252 / 1e-86 Protein of unknown function (DUF1068) (.1) Lus10030034 [exp] 78 / 3e-18 AT1G05070 250 / 1e-85 Protein of unknown function (DUF1068) (.1) Lus10020038 [exp] 71 / 1e-15 AT1G05070 167 / 4e-53 Protein of unknown function (DUF1068) (.1) Lus10015556 [exp] 70 / 3e-15 AT1G05070 179 / 4e-58 Protein of unknown function (DUF1068) (.1) Lus10029975 [exp] 56 / 7e-10 AT2G32580 109 / 3e-30 Protein of unknown function (DUF1068) (.1), Protein of unknown function (DUF1068) (.2) Lus10035349 [exp] 55 / 1e-09 AT2G32580 110 / 2e-30 Protein of unknown function (DUF1068) (.1), Protein of unknown function (DUF1068) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06364 [poplar] [flax] DUF1068 Protein of unknown function (DUF1068)
Representative CDS sequence Show only first row Show all	>Potri.006G187800.1 pacid=42769693 polypeptide=Potri.006G187800.1.p locus=Potri.006G187800 ID=Potri.006G187800.1.v4.1 annot-version=v4.1 ATGTCAAGGAGATCAGGGACTTGCTTGAGGTGTTGTTTGGTCTTTTTTGCAGTTATTTCAGCTTTAGGTGTGTGTGGTCCTGCTTTATACTGGAGATTCA AGAAGACTGTTGGATTTCCTGATTCTAAAACCTCTTCTTGTCCTCCTTGCATCTGTGACTGCCCCCCTCCTTTGTCTCTTCTCAAGATTGCTCCTGGGTT GGCCAACCTTTCAGTCACAGATTGTGGAAGTAATGACCCCGATCTCAAAACGGAGATGGAGAAGCAATTTGTGGACCTTCTAACAGAGGAGTTGAAATTG CAAGAGGCTGTTGCTCAAGAGCATGCTCATCACATGAACATCACGCTTGGTGAAGCAAAAAGGGTGGCATCCCAATACCAGAGGGAGGCAGAAAAATGCA ATGCTGCCACTGAAACATGCGAGGAGGCAAGAGAGCGGTCTGAAGCATTGCTGATTAGAGAGAGGAAAGTTACTTCCTTATGGGAGGAACGGGCCCGCCA ACTGGGCTATGAAGGAGAGTAA
AA sequence Show only first row Show all	>Potri.006G187800.1 pacid=42769693 polypeptide=Potri.006G187800.1.p locus=Potri.006G187800 ID=Potri.006G187800.1.v4.1 annot-version=v4.1 MSRRSGTCLRCCLVFFAVISALGVCGPALYWRFKKTVGFPDSKTSSCPPCICDCPPPLSLLKIAPGLANLSVTDCGSNDPDLKTEMEKQFVDLLTEELKL QEAVAQEHAHHMNITLGEAKRVASQYQREAEKCNAATETCEEARERSEALLIRERKVTSLWEERARQLGYEGE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G30996		NKS1	NA\(+\)- AND K\(+\)-SENSITIVE ...		Potri.006G187800 [exp]	0	1
AT2G45730			eukaryotic initiation factor 3...		Potri.005G238200 [exp]	5.65	0.7214
AT3G56130			biotin/lipoyl attachment domai...		Potri.010G183200 [exp]	6.63	0.6871
AT5G38630		ACYB-1	cytochrome B561-1 (.1)		Potri.017G111700 [exp]	9.16	0.7734
AT5G55190		RAN3, ATRAN3	RAN GTPase 3 (.1)		Potri.018G030900 [exp]	9.79	0.7688
AT3G62790			NADH-ubiquinone oxidoreductase...		Potri.002G204800 [exp]	12.80	0.7576
AT1G76140			Prolyl oligopeptidase family p...		Potri.005G247300 [exp]	18.43	0.7170
AT1G16900			Alg9-like mannosyltransferase ...		Potri.011G110800 [exp]	20.85	0.7017
AT2G16430		ATPAP10, PAP10	purple acid phosphatase 10 (.1...		Potri.005G233400 [exp]	22.44	0.7018	Pt-PAP1.2
AT3G09735			S1FA-like DNA-binding protein ...		Potri.006G130200 [exp]	28.89	0.7514	S1FA3.1
AT4G12340			copper ion binding (.1)		Potri.001G118700 [exp]	31.55	0.7348

Compare expression of checked genes

Potri.006G187800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.