Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-CHI5.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19810 378 / 3e-130 ChiC class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19820 324 / 2e-109 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19800 325 / 4e-109 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19750 285 / 7e-94 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19760 281 / 3e-92 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19720 276 / 1e-90 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19730 229 / 2e-72 Glycosyl hydrolase superfamily protein (.1) AT4G19770 224 / 1e-71 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19740 144 / 4e-41 Glycosyl hydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G188400 [exp] 393 / 2e-136 AT4G19810 477 / 2e-169 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G111900 [exp] 249 / 1e-75 AT3G16030 367 / 2e-114 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.018G112000 [exp] 237 / 3e-75 AT4G19810 284 / 3e-93 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G112100 [exp] 236 / 2e-74 AT4G19810 279 / 3e-91 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G111600 [exp] 238 / 1e-71 AT4G23180 377 / 2e-120 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.018G111700 [exp] 235 / 1e-70 AT4G23200 363 / 1e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G111800 [exp] 233 / 9e-70 AT4G23200 362 / 4e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.006G261800 [exp] 226 / 2e-69 AT4G19810 286 / 2e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.006G262001 [exp] 222 / 9e-69 AT4G19810 283 / 2e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019060 [exp] 424 / 7e-145 AT4G19810 437 / 1e-149 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036306 [exp] 387 / 1e-133 AT4G19810 397 / 6e-138 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036311 [exp] 331 / 9e-112 AT4G19810 377 / 5e-130 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036310 [exp] 225 / 7e-72 AT4G19810 277 / 3e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10018329 [exp] 211 / 7e-65 AT4G19810 268 / 1e-86 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036315 [exp] 199 / 1e-60 AT4G19820 253 / 3e-81 Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10017124 [exp] 196 / 4e-59 AT4G19810 260 / 9e-84 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10019061 [exp] 198 / 7e-57 AT4G21380 338 / 5e-104 receptor kinase 3 (.1) Lus10040021 [exp] 192 / 3e-56 AT4G19810 278 / 5e-89 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10041639 [exp] 148 / 6e-39 AT4G11900 338 / 7e-104 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [poplar] [flax] Glyco_hydro_tim PF00704 [poplar] [flax] Glyco_hydro_18 Glycosyl hydrolases family 18
Representative CDS sequence Show only first row Show all	>Potri.006G188300.1 pacid=42769336 polypeptide=Potri.006G188300.1.p locus=Potri.006G188300 ID=Potri.006G188300.1.v4.1 annot-version=v4.1 ATGGCAATCAACATCATTCCTCTTTTCTTCTCCATCTTCCTTGTTTCATTTCAGCCCTACTTCTCCGTCGGCCAAACTGTTGTCAAAGGTGGTTACTGGT TTCCTGGTAGCGGCTTTGCAGTTTCTGACATAAATTCTACTCTTTTCACTCACCTTTTCTGTGCATTTGCCGATGTCAATAGCCAAACATATCAAGTTAC AATCTCAACTTCCAACCAAGCTCAATTCCAAACCTTCACCAAGACGGTCCAACAAAAAAACCCTTCAGTGAAAACCCTTTTATCAATTGGTGGAGGTGGC TCCGATGTAAACACATTTGCTTCAATGGCTAGCCAGTCAAGTTCTCGTAAATCATTTATTGATTCCTCCATCACGTTAGCAAGGTCTAACAATTTTCTTG GCCTTGACCTTGACTGGGAGTACCCTTCTGATTCTACACAAATGAACAATTTTGGCACCCTTCTTACTGAGTGGAGGGCTGCTGTGGTCACTGAGGCTAA AAGTTCTGGCAAGACACCATTGATGTTATCTGCAGCAGTTCTTTACTTATCATATTACTACTCATCCTCGGTGACGTACCCTATCCAGGCTATATCAAAC AGCCTGGATTGGATTAATCTAATGGCATATGATTTTTATGGCCCAGGATGGTCTCCATCAAGCACGGGACCTCCTGCTGCTTTATACAATTCTGGGAATC TAGAAAGTGGAGACAATGGGGTCAGGTCCTGGATTCAGGCTGGCATGTCTGCAAAGAAACTAGTTCTTGGCCTTCCCTTTTATGGCTGGTCATGGCGTCT GACAAATTCGAATAACAATGGCCTTTTTGCACCGGCCAATGGACAAGGCCTAGCAGGAGATGGATCAATAGGCTACAATCAGATCAAGCAGTACATAACC CAAAATAGAGCTACTAAAGTATTCAATGTCACTGTTGTTACAGACTATTGTTACAGTGGAACTACATGGATTGGCTACGATGATACTCAGAGTATCTCCA CCAAGGTTGCATATGCTAAAGGGAAAGGCTTGTTAGGTTACTTTGCCTGGCATGTAGGTGCCGATGACAATTGGGCCCTTTCTTCTAAAGCATTGCAGAC ATGGGGAGCATAG
AA sequence Show only first row Show all	>Potri.006G188300.1 pacid=42769336 polypeptide=Potri.006G188300.1.p locus=Potri.006G188300 ID=Potri.006G188300.1.v4.1 annot-version=v4.1 MAINIIPLFFSIFLVSFQPYFSVGQTVVKGGYWFPGSGFAVSDINSTLFTHLFCAFADVNSQTYQVTISTSNQAQFQTFTKTVQQKNPSVKTLLSIGGGG SDVNTFASMASQSSSRKSFIDSSITLARSNNFLGLDLDWEYPSDSTQMNNFGTLLTEWRAAVVTEAKSSGKTPLMLSAAVLYLSYYYSSSVTYPIQAISN SLDWINLMAYDFYGPGWSPSSTGPPAALYNSGNLESGDNGVRSWIQAGMSAKKLVLGLPFYGWSWRLTNSNNNGLFAPANGQGLAGDGSIGYNQIKQYIT QNRATKVFNVTVVTDYCYSGTTWIGYDDTQSISTKVAYAKGKGLLGYFAWHVGADDNWALSSKALQTWGA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G19810		ChiC	class V chitinase, Glycosyl hy...		Potri.006G188300 [exp]	0	1	Pt-CHI5.2
AT1G11670			MATE efflux family protein (.1...		Potri.011G002200 [exp]	1.41	0.9695
AT4G21200		ATGA2OX8	ARABIDOPSIS THALIANA GIBBERELL...		Potri.011G134000 [exp]	2.64	0.9405
AT4G33800			unknown protein		Potri.001G292100 [exp]	4.69	0.9171
AT1G75800			Pathogenesis-related thaumatin...		Potri.001G221200 [exp]	6.16	0.9538
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Potri.011G029900 [exp]	7.34	0.9245
AT3G22640		PAP85	cupin family protein (.1)		Potri.006G002500 [exp]	7.54	0.9477
AT2G46640			unknown protein		Potri.014G102600 [exp]	10.58	0.9448
					Potri.007G097700 [exp]	13.26	0.9400
AT3G18010	HD	WOX1	WUSCHEL related homeobox 1 (.1...		Potri.015G039100 [exp]	13.85	0.9436
AT3G02500			unknown protein		Potri.017G112600 [exp]	14.07	0.9382

Compare expression of checked genes

Potri.006G188300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.