Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31985 99 / 1e-29 Ribosomal protein L39 family protein (.1) AT3G02190 94 / 6e-28 Ribosomal protein L39 family protein (.1) AT2G25210 86 / 1e-24 Ribosomal protein L39 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G022100 [exp] 104 / 6e-32 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) Potri.018G112301 [exp] 104 / 6e-32 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) Potri.006G260500 [exp] 104 / 6e-32 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1) Potri.006G260837 [exp] 104 / 6e-32 AT4G31985 98 / 1e-29 Ribosomal protein L39 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002220 [exp] 98 / 4e-29 ND 99 / 1e-29 Lus10019065 [exp] 97 / 1e-28 AT4G31985 100 / 2e-29 Ribosomal protein L39 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00832 [poplar] [flax] Ribosomal_L39 Ribosomal L39 protein
Representative CDS sequence Show only first row Show all	>Potri.006G188500.1 pacid=42767973 polypeptide=Potri.006G188500.1.p locus=Potri.006G188500 ID=Potri.006G188500.1.v4.1 annot-version=v4.1 ATGCCGTCACACAAGACCTTCAGGATCAAGAAGAAGCTGGCGAAGAAGATGAGGCAGAACAGGCCTATCCCTCACTGGATCCGTATGAGAACTGATAACA CCATCAGGTACAATGCGAAGCGCAGGCACTGGCGACGTACCAAACTAGGGTTTTGA
AA sequence Show only first row Show all	>Potri.006G188500.1 pacid=42767973 polypeptide=Potri.006G188500.1.p locus=Potri.006G188500 ID=Potri.006G188500.1.v4.1 annot-version=v4.1 MPSHKTFRIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAKRRHWRRTKLGF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G31985			Ribosomal protein L39 family p...		Potri.006G188500 [exp]	0	1
AT4G39200			Ribosomal protein S25 family p...		Potri.004G157200 [exp]	2.44	0.8862
AT3G10950			Zinc-binding ribosomal protein...		Potri.002G140100 [exp]	3.16	0.8773
AT1G22270			Trm112p-like protein (.1)		Potri.005G165000 [exp]	7.48	0.8071
AT3G49910			Translation protein SH3-like f...		Potri.007G055900 [exp]	9.16	0.8361
AT3G07230			wound-responsive protein-relat...		Potri.002G246300 [exp]	9.94	0.8320
AT3G55280		RPL23A2, RPL23A...	RIBOSOMAL PROTEIN L23A2, ribos...		Potri.010G210300 [exp]	12.24	0.8436	ATRPL23.2
AT3G05560			Ribosomal L22e protein family ...		Potri.002G204100 [exp]	12.84	0.8589	RPL22.4
AT1G03150			Acyl-CoA N-acyltransferases (N...		Potri.005G210400 [exp]	14.28	0.7533	SGB903
AT1G27435			unknown protein		Potri.001G325000 [exp]	18.38	0.7923
AT5G65860			ankyrin repeat family protein ...		Potri.014G019000 [exp]	18.65	0.7860

Compare expression of checked genes

Potri.006G188500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.