Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G35170 160 / 2e-47 adenylate kinase family protein (.1.2) AT5G47840 128 / 2e-37 AMK2 adenosine monophosphate kinase (.1) AT5G50370 80 / 3e-19 Adenylate kinase family protein (.1) AT5G26667 79 / 6e-19 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) AT3G60180 78 / 1e-18 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT5G63400 76 / 6e-18 ADK1 adenylate kinase 1 (.1.2) AT4G25280 76 / 1e-17 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G39270 71 / 2e-15 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G37250 67 / 6e-14 ADK, ATPADK1 adenosine kinase (.1) AT3G01820 48 / 2e-07 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G113400 [exp] 179 / 2e-54 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2) Potri.013G103400 [exp] 128 / 3e-37 AT5G47840 347 / 1e-120 adenosine monophosphate kinase (.1) Potri.019G078200 [exp] 126 / 1e-36 AT5G47840 332 / 8e-115 adenosine monophosphate kinase (.1) Potri.014G043300 [exp] 78 / 9e-19 AT5G26667 358 / 2e-127 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Potri.012G095300 [exp] 77 / 7e-18 AT5G63400 419 / 1e-150 adenylate kinase 1 (.1.2) Potri.002G134600 [exp] 76 / 8e-18 AT5G26667 345 / 1e-122 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Potri.014G104700 [exp] 73 / 7e-17 AT5G26667 275 / 8e-95 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Potri.015G092800 [exp] 72 / 3e-16 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2) Potri.008G046100 [exp] 72 / 4e-16 AT2G37250 377 / 1e-132 adenosine kinase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036326 [exp] 175 / 2e-53 AT5G35170 658 / 0.0 adenylate kinase family protein (.1.2) Lus10037995 [exp] 126 / 2e-37 AT5G47840 315 / 9e-110 adenosine monophosphate kinase (.1) Lus10009228 [exp] 125 / 2e-36 AT5G47840 296 / 3e-101 adenosine monophosphate kinase (.1) Lus10009478 [exp] 121 / 7e-36 AT5G47840 293 / 1e-101 adenosine monophosphate kinase (.1) Lus10003504 [exp] 122 / 2e-35 AT5G47840 300 / 1e-102 adenosine monophosphate kinase (.1) Lus10031611 [exp] 77 / 3e-18 AT5G26667 343 / 1e-121 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Lus10016757 [exp] 76 / 2e-17 AT5G63400 416 / 2e-149 adenylate kinase 1 (.1.2) Lus10022453 [exp] 76 / 2e-17 AT5G63400 411 / 2e-147 adenylate kinase 1 (.1.2) Lus10033733 [exp] 76 / 4e-17 AT5G26667 336 / 2e-117 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Lus10023476 [exp] 71 / 3e-15 AT2G37250 407 / 2e-144 adenosine kinase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00406 [poplar] [flax] ADK Adenylate kinase
Representative CDS sequence Show only first row Show all	>Potri.006G189201.2 pacid=42767892 polypeptide=Potri.006G189201.2.p locus=Potri.006G189201 ID=Potri.006G189201.2.v4.1 annot-version=v4.1 ATGATATCCGGTGCACCGGCATCTGGCAAAGGCACTCAGTGTGAACTAATTGTTAAGAAATTTGGATCGGTACACATCTCAACTGGAGATCTTCTAAGAG CTGAAGTATCTGCGGGGACAGAAATTGGCAATAAAGCAAAAGAATTTATGAATGCTGCTCGTCTGGTTCCTGATGAAATTGTGACAGCTATGCTGACATC GCTATTATCATATGATGATGAAAAGGAAACATGGTGGCTTCTAGATGGCTATCCGCATAGTTCTGCCCAAGCAGAAAGTCTTGAGAAATTGAATGTAAAG GCACGTCTTGAAATATACAAGAAAAATGCTGAATATCCACATGCTCAAACATTATTGTCAAGATTGATGGAAACCACCAAAAAGAAGTAG
AA sequence Show only first row Show all	>Potri.006G189201.2 pacid=42767892 polypeptide=Potri.006G189201.2.p locus=Potri.006G189201 ID=Potri.006G189201.2.v4.1 annot-version=v4.1 MISGAPASGKGTQCELIVKKFGSVHISTGDLLRAEVSAGTEIGNKAKEFMNAARLVPDEIVTAMLTSLLSYDDEKETWWLLDGYPHSSAQAESLEKLNVK ARLEIYKKNAEYPHAQTLLSRLMETTKKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G35170			adenylate kinase family protei...		Potri.006G189201 [exp]	0	1
AT1G03670			ankyrin repeat family protein ...		Potri.018G077766 [exp]	7.34	0.9286
AT4G09660			unknown protein		Potri.014G176225 [exp]	12.24	0.9108
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Potri.001G015601 [exp]	12.96	0.9068
AT2G44930			Plant protein of unknown funct...		Potri.012G012500 [exp]	14.07	0.9083
AT1G01320			Tetratricopeptide repeat (TPR)...		Potri.014G098600 [exp]	15.74	0.9110
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Potri.001G015500 [exp]	16.58	0.8998
AT1G04920		ATSPS3F	sucrose phosphate synthase 3F ...		Potri.001G317600 [exp]	16.91	0.9200
					Potri.001G076600 [exp]	21.49	0.8922
AT1G01320			Tetratricopeptide repeat (TPR)...		Potri.002G170900 [exp]	23.32	0.9068
AT5G37360			unknown protein		Potri.019G023700 [exp]	25.09	0.8990

Compare expression of checked genes

Potri.006G189201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.