Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G35110 70 / 2e-16 unknown protein AT2G46490 69 / 4e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G113700 [exp] 157 / 5e-51 AT5G35110 78 / 1e-19 unknown protein Potri.018G113901 [exp] 73 / 2e-16 AT5G35110 58 / 1e-10 unknown protein Potri.006G189700 [exp] 66 / 4e-15 AT5G35110 50 / 5e-09 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040009 [exp] 70 / 2e-16 AT2G46490 74 / 7e-18 unknown protein Lus10019579 [exp] 70 / 3e-16 AT2G46490 73 / 1e-17 unknown protein Lus10000088 [exp] 57 / 1e-11 AT2G46490 49 / 2e-08 unknown protein Lus10006298 [exp] 57 / 1e-11 AT2G46490 49 / 2e-08 unknown protein Lus10000078 [exp] 56 / 5e-11 AT5G35110 49 / 1e-08 unknown protein Lus10006299 [exp] 56 / 5e-11 AT5G35110 49 / 1e-08 unknown protein Lus10006300 [exp] 56 / 5e-11 AT5G35110 49 / 1e-08 unknown protein Lus10003182 [exp] 46 / 2e-07 AT2G46490 49 / 7e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G189600.1 pacid=42770570 polypeptide=Potri.006G189600.1.p locus=Potri.006G189600 ID=Potri.006G189600.1.v4.1 annot-version=v4.1 ATGGCCGCAGGAGCTGCCGATGGGTTCTTCCGTTATGTCCATGACGGTTGTCTCTCCGGTGGTGAGATGGGTATTGATCGTAGGCCATACCATCGCAATT GCAGCTGTGCGCTTCACAAATCCAAAGAGAATTGTTCACATGCAATGTCAAGGTATAAAAATGTGTCGTATCCAATAAAAAGGTGTTGGAGTGAAGGAAG TTTGGCTTTGATGGTTGCTAATTCTTCTTCTTGTTGTCATTCCCCTCCATCTTCTTCACCTTCTTTACAAGCGGGGAAGAGTACTGCCACCCCTCATCAA AGGAGGTTAAGCCATGATCTTGATCTTGAAGACCAAGTGTGTTCTTTTAAGGTCTGA
AA sequence Show only first row Show all	>Potri.006G189600.1 pacid=42770570 polypeptide=Potri.006G189600.1.p locus=Potri.006G189600 ID=Potri.006G189600.1.v4.1 annot-version=v4.1 MAAGAADGFFRYVHDGCLSGGEMGIDRRPYHRNCSCALHKSKENCSHAMSRYKNVSYPIKRCWSEGSLALMVANSSSCCHSPPSSSPSLQAGKSTATPHQ RRLSHDLDLEDQVCSFKV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G35110			unknown protein		Potri.006G189600 [exp]	0	1
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Potri.006G134900 [exp]	12.32	0.9466
AT5G04820	OFP	ATOFP13, OFP13	ARABIDOPSIS THALIANA OVATE FAM...		Potri.006G205500 [exp]	20.44	0.9431
AT3G01550		ATPPT2	phosphoenolpyruvate (pep)/phos...		Potri.001G347300 [exp]	25.09	0.9426
AT5G64290		DCT, DIT2.1	dicarboxylate transport 2.1 (....		Potri.001G310600 [exp]	28.98	0.9420
					Potri.006G055701 [exp]	29.34	0.8568
AT3G60130		BGLU16	beta glucosidase 16 (.1.2.3)		Potri.001G225808 [exp]	35.24	0.9417
AT4G38840			SAUR-like auxin-responsive pro...		Potri.004G164800 [exp]	38.79	0.9415
AT2G40610		ATHEXPALPHA1.11...	expansin A8 (.1)		Potri.006G108000 [exp]	39.19	0.9414
AT2G39730		RCA	rubisco activase (.1.2.3)		Potri.016G101100 [exp]	39.86	0.8881
AT2G45180			Bifunctional inhibitor/lipid-t...		Potri.006G256100 [exp]	43.98	0.9413

Compare expression of checked genes

Potri.006G189600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.