Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25240 65 / 3e-14 unknown protein AT5G62865 59 / 7e-12 unknown protein AT3G48020 50 / 1e-08 unknown protein AT5G14890 51 / 2e-08 NHL domain-containing protein (.1) AT3G01430 50 / 3e-08 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G114200 [exp] 222 / 4e-76 AT5G62865 57 / 1e-10 unknown protein Potri.006G259300 [exp] 69 / 1e-15 AT5G25240 47 / 2e-07 unknown protein Potri.015G073800 [exp] 61 / 3e-12 AT5G62865 87 / 5e-22 unknown protein Potri.003G101300 [exp] 57 / 6e-11 AT5G14890 125 / 6e-34 NHL domain-containing protein (.1) Potri.012G078300 [exp] 54 / 6e-10 AT5G62865 77 / 6e-18 unknown protein Potri.001G132100 [exp] 49 / 4e-08 AT3G01430 122 / 7e-36 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006290 [exp] 71 / 1e-16 AT5G25240 67 / 5e-15 unknown protein Lus10001932 [exp] 70 / 7e-16 AT5G14890 76 / 1e-17 NHL domain-containing protein (.1) Lus10001942 [exp] 69 / 1e-15 AT5G14890 79 / 1e-17 NHL domain-containing protein (.1) Lus10001933 [exp] 69 / 1e-15 AT5G14890 78 / 4e-17 NHL domain-containing protein (.1) Lus10003184 [exp] 69 / 1e-14 AT1G04700 94 / 3e-21 PB1 domain-containing protein tyrosine kinase (.1) Lus10033413 [exp] 54 / 6e-10 AT5G14890 96 / 3e-23 NHL domain-containing protein (.1) Lus10032160 [exp] 42 / 3e-05 AT5G14890 82 / 1e-19 NHL domain-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.006G190100.1 pacid=42770375 polypeptide=Potri.006G190100.1.p locus=Potri.006G190100 ID=Potri.006G190100.1.v4.1 annot-version=v4.1 ATGAGCCCCATCGACTCGCCAAGAATGTCCCATGAACAAGAAGGATATGATCACCTTGATGATTATGAAGAAGAGGCATATTCAGCTAACGGTTGCTGTT GTTTTCGACTATTCACGTTCAACTTGAGGCGGAACAATGAACGGGAATATGATATTTTGAACGAGAATGGTGACCATAGAGATCCATGGTTGGTGAGGAA ACTGAAGAAAGTAAAAGAGGCTTCAGAGATAGTGGCAGGGCCAAAGTGGAAGACATTCATTAGAAAGATTGGTGCATATATCAAGAAGAGGAAACAGAGG AATAATCAGGCTCCGTATGATGCTGAAAGCTATGCTCTCAACTTTGATAGGGAAGAAGATGCTGTTTGA
AA sequence Show only first row Show all	>Potri.006G190100.1 pacid=42770375 polypeptide=Potri.006G190100.1.p locus=Potri.006G190100 ID=Potri.006G190100.1.v4.1 annot-version=v4.1 MSPIDSPRMSHEQEGYDHLDDYEEEAYSANGCCCFRLFTFNLRRNNEREYDILNENGDHRDPWLVRKLKKVKEASEIVAGPKWKTFIRKIGAYIKKRKQR NNQAPYDAESYALNFDREEDAV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G25240			unknown protein		Potri.006G190100 [exp]	0	1
AT5G63140		ATPAP29, PAP29	purple acid phosphatase 29 (.1...		Potri.002G183000 [exp]	4.24	0.8200
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.003G014750 [exp]	4.89	0.7815
AT3G16510			Calcium-dependent lipid-bindin...		Potri.003G160400 [exp]	5.74	0.8287
AT1G09070		(AT)SRC2, (AT)S...	soybean gene regulated by cold...		Potri.005G026700 [exp]	7.14	0.8180
AT2G02360		ATPP2-B10	phloem protein 2-B10 (.1)		Potri.001G050100 [exp]	7.34	0.8036
AT1G07530	GRAS	SCL14, ATGRAS2	GRAS \(GAI, RGA, SCR\) 2, ARAB...		Potri.009G033300 [exp]	14.14	0.8175
AT3G56880			VQ motif-containing protein (....		Potri.006G032300 [exp]	15.49	0.8058
AT4G17230	GRAS	SCL13	SCARECROW-like 13 (.1)		Potri.016G009700 [exp]	18.02	0.7730
AT5G66320	GATA	GATA5	GATA transcription factor 5 (....		Potri.004G161500 [exp]	18.76	0.7649
AT5G41810			unknown protein		Potri.001G093500 [exp]	30.16	0.7852

Compare expression of checked genes

Potri.006G190100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.