Potri.006G192100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42140 85 / 4e-21 VQ motif-containing protein (.1)
AT3G58000 85 / 4e-21 VQ motif-containing protein (.1)
AT2G44340 84 / 1e-20 VQ motif-containing protein (.1)
AT3G60090 82 / 5e-20 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G046000 239 / 1e-81 AT3G58000 120 / 1e-34 VQ motif-containing protein (.1)
Potri.009G024200 98 / 3e-26 AT3G58000 73 / 7e-17 VQ motif-containing protein (.1)
Potri.001G230800 87 / 5e-22 AT2G44340 79 / 6e-19 VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004172 73 / 1e-15 AT2G42140 72 / 2e-15 VQ motif-containing protein (.1)
Lus10021054 71 / 3e-15 AT2G44340 76 / 7e-17 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.006G192100.1 pacid=42768194 polypeptide=Potri.006G192100.1.p locus=Potri.006G192100 ID=Potri.006G192100.1.v4.1 annot-version=v4.1
ATGGAGGATCTTATGATGAGGAAACGACCAGCCTTTATGCCTAGTTCAATCACTCCTGCATCACCACTAACCATGCATAGAGATTCACACACAATAGACA
AAGTCAAGCCAAAGATACGCATAATTCACATCTTTGCTCCTGAAATCATCAAGACGGATGTTGCAAACTTCAGAGAGTTGGTGCAAAGACTTACAGGGAA
ACCAACTGTTCAAAAGGGGGGTTGCAAGAAGAAAGCAACAAGCGCAAGAACACAGGATCAACCAAGAAACTGCAACAACAACAACAACAACTACTTATGT
GACAACAAGCCTGTTATGACCAAGAAAGTTGAGCTAAGGAGCGGGTTTGGGAGTACTTTGGGGTCTAGAGAAAGAGTTAAAGAGGAAGAAGAAATATGGA
ATGGTCCAAATTCAGGTGGGTTCTTAGGTGGATTTACAGATTTGGATGGTTTCATTCAAGAGCTTGGTGAATTTCCATTGCTGCCAATGGATGCTAATCA
CATGCAAGGGTTCGGGGAGACTCAACTTGCCTAA
AA sequence
>Potri.006G192100.1 pacid=42768194 polypeptide=Potri.006G192100.1.p locus=Potri.006G192100 ID=Potri.006G192100.1.v4.1 annot-version=v4.1
MEDLMMRKRPAFMPSSITPASPLTMHRDSHTIDKVKPKIRIIHIFAPEIIKTDVANFRELVQRLTGKPTVQKGGCKKKATSARTQDQPRNCNNNNNNYLC
DNKPVMTKKVELRSGFGSTLGSRERVKEEEEIWNGPNSGGFLGGFTDLDGFIQELGEFPLLPMDANHMQGFGETQLA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G42140 VQ motif-containing protein (.... Potri.006G192100 0 1
AT3G12580 ATHSP70, HSP70 ARABIDOPSIS HEAT SHOCK PROTEIN... Potri.008G054900 2.64 0.9432 HSP70.7
AT1G75130 CYP721A1 "cytochrome P450, family 721, ... Potri.005G035200 4.89 0.9269
AT3G46660 UGT76E12 UDP-glucosyl transferase 76E12... Potri.009G038950 7.54 0.9023
AT1G75130 CYP721A1 "cytochrome P450, family 721, ... Potri.014G180500 8.36 0.9197
AT5G07010 ATST2A ARABIDOPSIS THALIANA SULFOTRAN... Potri.001G036600 10.48 0.9255
AT3G18710 ATPUB29 ARABIDOPSIS THALIANA PLANT U-B... Potri.002G070500 16.00 0.9052
AT3G14460 LRR and NB-ARC domains-contain... Potri.003G200800 16.79 0.9242
AT5G10530 Concanavalin A-like lectin pro... Potri.001G283866 16.91 0.9097
AT5G10530 Concanavalin A-like lectin pro... Potri.001G283208 16.91 0.9092
AT5G58240 FHIT FRAGILE HISTIDINE TRIAD (.1.2) Potri.013G161100 17.60 0.9129

Potri.006G192100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.