Potri.006G192500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42110 74 / 1e-17 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G045700 147 / 7e-46 AT2G42110 100 / 7e-28 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016261 61 / 4e-12 AT2G42110 83 / 9e-21 unknown protein
Lus10029282 55 / 4e-10 AT2G42110 82 / 1e-20 unknown protein
PFAM info
Representative CDS sequence
>Potri.006G192500.3 pacid=42767318 polypeptide=Potri.006G192500.3.p locus=Potri.006G192500 ID=Potri.006G192500.3.v4.1 annot-version=v4.1
ATGGTCACTGCTGATAAAAACTCTAGTAGTACTACAGTTCAACATGTAACCAAGAAATCTTCGGATGAGTTGCTGAGGAAATTTGCTGAAGAAATGAGTG
ATGATGATGCTAATGAGGCTAAGAAATTGGAGCTGGCAAGGGTGTTAAAAAGGAGAAAAAGGAGGAAGACAAGAAGGGATTTCGAAAGTGGTAATTTATG
CGAAAGTCCATCACATTATAAGTCGAGTTCCAGCTTAGTGGAGAGGAGGTCACTTCTTCCTCCGGTGACAAGGAAATCTGTATTGCTGAGGCAACTTGGG
ATCGGAAGGTTACAGCTCAAAGCGAGGGATACCAAGAGCAAGTCAATCCTGGCTTCCATTGAAAAGACATGGCGCAGGACTGTAGAAGGAGCCTCAAAAG
TACTGTTGGAGAAGCATTACAATCGACACAGGCGTTTGATTAACGATATGATCTAG
AA sequence
>Potri.006G192500.3 pacid=42767318 polypeptide=Potri.006G192500.3.p locus=Potri.006G192500 ID=Potri.006G192500.3.v4.1 annot-version=v4.1
MVTADKNSSSTTVQHVTKKSSDELLRKFAEEMSDDDANEAKKLELARVLKRRKRRKTRRDFESGNLCESPSHYKSSSSLVERRSLLPPVTRKSVLLRQLG
IGRLQLKARDTKSKSILASIEKTWRRTVEGASKVLLEKHYNRHRRLINDMI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G42110 unknown protein Potri.006G192500 0 1
AT5G06150 CYC1BAT, CYCB1;... cyclin B 1;2, Cyclin family pr... Potri.006G035200 1.00 0.9795
AT4G15830 ARM repeat superfamily protein... Potri.008G221700 3.16 0.9785
AT1G08560 KN, ATSYP111, S... KNOLLE, syntaxin of plants 11... Potri.013G053200 3.74 0.9673 Pt-SYP111.1
AT5G23860 TUB8, b-TUB tubulin beta 8 (.1.2) Potri.009G040200 4.47 0.9736
AT1G76540 CDKB2;1 cyclin-dependent kinase B2;1 (... Potri.005G257500 4.47 0.9683 CDKB2.2
AT5G01910 unknown protein Potri.006G109400 5.19 0.9412
AT5G45700 Haloacid dehalogenase-like hyd... Potri.004G062900 6.92 0.9642
AT2G17620 CYCB2;1 Cyclin B2;1 (.1) Potri.005G100000 8.48 0.9593 Pt-CYCMS1.1
AT3G51740 IMK2 inflorescence meristem recepto... Potri.006G104300 8.94 0.9490 Pt-RHG1.3
AT5G67270 ATEB1C, ATEB1H1 ATEB1-HOMOLOG1, MICROTUBULE EN... Potri.005G142200 12.64 0.9581

Potri.006G192500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.