Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44290 146 / 2e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44300 146 / 2e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G55260 145 / 9e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G58550 140 / 2e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73890 68 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 64 / 5e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G27950 58 / 1e-10 LTPG1 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) AT4G14815 53 / 7e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 52 / 2e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 52 / 2e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G232000 [exp] 161 / 2e-50 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G008500 [exp] 147 / 5e-45 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G217000 [exp] 142 / 6e-43 AT1G55260 149 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.015G054000 [exp] 66 / 1e-13 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G053700 [exp] 66 / 1e-13 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G056200 [exp] 57 / 2e-10 AT1G27950 149 / 1e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.003G172400 [exp] 56 / 8e-10 AT1G27950 145 / 5e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.010G085400 [exp] 53 / 9e-09 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 50 / 5e-08 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042449 [exp] 134 / 1e-39 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10035975 [exp] 130 / 1e-35 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1) Lus10026220 [exp] 122 / 1e-33 AT2G44300 131 / 6e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033076 [exp] 98 / 2e-25 AT2G44290 114 / 6e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017749 [exp] 95 / 2e-24 AT2G44290 115 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 64 / 5e-13 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10037027 [exp] 59 / 9e-11 AT1G27950 147 / 3e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10042984 [exp] 56 / 6e-10 AT1G73890 81 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10006413 [exp] 56 / 6e-10 AT1G27950 137 / 5e-41 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10015779 [exp] 56 / 1e-09 AT1G27950 144 / 8e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.006G195700.1 pacid=42767587 polypeptide=Potri.006G195700.1.p locus=Potri.006G195700 ID=Potri.006G195700.1.v4.1 annot-version=v4.1 ATGGCAAAAACAATGTGTTCTGAGGTCGTTCATGCCATGGTCTCAAGCATTGTAGTCTTGATGATGTTTAATTTTGTCTTCTCAGATTTGGCTGCGGATA AACGAGAGTGTAATGAGCAGTTGGCTAGCCTCTCAGCATGCCTACCTTTTGTTGGCGGCGACACAAAAGTTCCTACTCCAACATGTTGCAGCGGATTAAG ACAAGAAATTAGCAAGACAGAGAAGTGTCTATGCATCCTAGTTAAGGATCGCAATGAACCCGACCTTGGCTTCAAGATCAATGCCACTCTTGCATTGAGC CTCCCTTCAATTTGTCACGCTCCTGCTAATGTTTCTGCATGCCCTGAAATGCTACATCTGGCTCCCAATTCAACAGATGCTCAAGTTTTCGAGGATTTTG CAGCAAGCAATAAGAGTAACGCAGTTGTTGCTGGCGTTCAAACCAGTTCAAGCAATACAATGAAGGAAAGGAAATGGCTTGAAGTGAGCATGGTTGCTGT TATCATTGAAGTGAGCATGGTTGCTGTTATCACATCAGCTCTCACCATTGCGGGTTAA
AA sequence Show only first row Show all	>Potri.006G195700.1 pacid=42767587 polypeptide=Potri.006G195700.1.p locus=Potri.006G195700 ID=Potri.006G195700.1.v4.1 annot-version=v4.1 MAKTMCSEVVHAMVSSIVVLMMFNFVFSDLAADKRECNEQLASLSACLPFVGGDTKVPTPTCCSGLRQEISKTEKCLCILVKDRNEPDLGFKINATLALS LPSICHAPANVSACPEMLHLAPNSTDAQVFEDFAASNKSNAVVAGVQTSSSNTMKERKWLEVSMVAVIIEVSMVAVITSALTIAG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G44290			Bifunctional inhibitor/lipid-t...		Potri.006G195700 [exp]	0	1
AT3G18170			Glycosyltransferase family 61 ...		Potri.015G042300 [exp]	1.00	0.9827
AT1G03700			Uncharacterised protein family...		Potri.019G100300 [exp]	2.00	0.9785
AT1G02520		MDR8, ABCB11, P...	multi-drug resistance 8, ATP-b...		Potri.014G113100 [exp]	3.00	0.9711
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Potri.001G270400 [exp]	5.91	0.9592
AT2G18360			alpha/beta-Hydrolases superfam...		Potri.007G024400 [exp]	6.00	0.9632
AT1G68360	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Potri.017G116300 [exp]	6.92	0.9168
AT4G03230			S-locus lectin protein kinase ...		Potri.013G150800 [exp]	7.41	0.9534
AT2G43840		UGT74F1	UDP-glycosyltransferase 74 F1 ...		Potri.014G175000 [exp]	9.16	0.9520	Pt-ZOG1.11
AT2G48090			unknown protein		Potri.014G137850 [exp]	9.38	0.9535
AT2G24430	NAC	ANAC039, ANAC03...	Arabidopsis NAC domain contain...		Potri.018G003800 [exp]	10.09	0.9561

Compare expression of checked genes

Potri.006G195700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.