Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G24780 183 / 4e-58 Pectin lyase-like superfamily protein (.1.2) AT3G27400 179 / 1e-56 Pectin lyase-like superfamily protein (.1) AT5G63180 174 / 3e-54 Pectin lyase-like superfamily protein (.1) AT4G13210 168 / 3e-52 Pectin lyase-like superfamily protein (.1.2) AT1G67750 167 / 1e-51 Pectate lyase family protein (.1) AT4G13710 167 / 3e-51 Pectin lyase-like superfamily protein (.1.2) AT5G48900 166 / 3e-51 Pectin lyase-like superfamily protein (.1) AT3G24670 166 / 6e-51 Pectin lyase-like superfamily protein (.1) AT3G07010 164 / 1e-50 Pectin lyase-like superfamily protein (.1) AT3G24230 163 / 6e-50 Pectate lyase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G087800 [exp] 191 / 8e-61 AT5G63180 657 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.012G091500 [exp] 189 / 2e-60 AT4G24780 645 / 0.0 Pectin lyase-like superfamily protein (.1.2) Potri.001G339500 [exp] 180 / 9e-57 AT4G24780 617 / 0.0 Pectin lyase-like superfamily protein (.1.2) Potri.008G182200 [exp] 173 / 3e-54 AT1G67750 671 / 0.0 Pectate lyase family protein (.1) Potri.010G051800 [exp] 169 / 2e-52 AT1G67750 645 / 0.0 Pectate lyase family protein (.1) Potri.014G178100 [exp] 165 / 1e-50 AT3G07010 652 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.002G238800 [exp] 163 / 6e-50 AT3G07010 655 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.003G175900 [exp] 162 / 1e-49 AT4G13710 681 / 0.0 Pectin lyase-like superfamily protein (.1.2) Potri.001G052300 [exp] 162 / 2e-49 AT4G13710 696 / 0.0 Pectin lyase-like superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013668 [exp] 191 / 8e-63 AT5G63180 424 / 2e-149 Pectin lyase-like superfamily protein (.1) Lus10013667 [exp] 190 / 2e-62 AT5G63180 469 / 4e-167 Pectin lyase-like superfamily protein (.1) Lus10033037 [exp] 190 / 2e-60 AT5G63180 671 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10042509 [exp] 167 / 4e-54 AT4G13710 367 / 3e-127 Pectin lyase-like superfamily protein (.1.2) Lus10036946 [exp] 171 / 3e-53 AT5G63180 627 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10014887 [exp] 169 / 2e-52 AT5G63180 620 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10022310 [exp] 168 / 5e-52 AT5G63180 626 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10011758 [exp] 168 / 5e-52 AT4G13710 703 / 0.0 Pectin lyase-like superfamily protein (.1.2) Lus10023679 [exp] 167 / 1e-51 AT4G13710 729 / 0.0 Pectin lyase-like superfamily protein (.1.2) Lus10011400 [exp] 166 / 2e-51 AT1G67750 623 / 0.0 Pectate lyase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [poplar] [flax] Pec_lyase-like PF00544 [poplar] [flax] Pectate_lyase_4 Pectate lyase
Representative CDS sequence Show only first row Show all	>Potri.006G196400.2 pacid=42770653 polypeptide=Potri.006G196400.2.p locus=Potri.006G196400 ID=Potri.006G196400.2.v4.1 annot-version=v4.1 ATGACCCACCATGATAAAGTCATGCTTCTGGGGCACAGCGATTCCTACACTCAAGACAAGAACATGCAAGTCACCATAGCCTTTAATCACTTTGGAGAAG GGCTTGTCCAGAGAATGCCAAGATGCAGACACGGGTATTTCCATGTGGTCAACAATGACTACACCCATTGGGAAATGTACGCCATTGGAGGGAGTGCTAA CCCGACCATCAACAGCCAAGGCAATAGATTTGTTGCGCCCGACATCAGGTTCAGTAAGGAGGTAAGAGCTGAGAACCCATTTATTGCCCAACTGAAATAA
AA sequence Show only first row Show all	>Potri.006G196400.2 pacid=42770653 polypeptide=Potri.006G196400.2.p locus=Potri.006G196400 ID=Potri.006G196400.2.v4.1 annot-version=v4.1 MTHHDKVMLLGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFVAPDIRFSKEVRAENPFIAQLK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G24780			Pectin lyase-like superfamily ...		Potri.006G196400 [exp]	0	1
AT5G63180			Pectin lyase-like superfamily ...		Potri.015G087800 [exp]	1.00	0.9831
AT4G13710			Pectin lyase-like superfamily ...		Potri.003G175900 [exp]	2.00	0.9479
AT1G70710		CEL1 ,AtGH9B1	CELLULASE 1, glycosyl hydrolas...		Potri.010G109200 [exp]	4.24	0.9124	Pt-CEL1.2
AT1G29240			Protein of unknown function (D...		Potri.011G067000 [exp]	5.47	0.9210
AT1G77110		PIN6	PIN-FORMED 6, Auxin efflux car...		Potri.002G072200 [exp]	5.47	0.9136
AT4G13710			Pectin lyase-like superfamily ...		Potri.001G052300 [exp]	6.48	0.8962
AT4G24780			Pectin lyase-like superfamily ...		Potri.012G091500 [exp]	6.63	0.9079
AT1G79680		ATWAKL10	WALL ASSOCIATED KINASE (WAK)-L...		Potri.018G148498 [exp]	7.74	0.9111
AT1G20070			unknown protein		Potri.005G241800 [exp]	8.06	0.9158
AT1G29240			Protein of unknown function (D...		Potri.004G057800 [exp]	8.48	0.9125

Compare expression of checked genes

Potri.006G196400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.