Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68450 59 / 3e-12 PDE337 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1) AT1G21326 45 / 9e-07 VQ motif-containing protein (.1) AT3G18360 43 / 8e-06 VQ motif-containing protein (.1) AT1G21320 39 / 0.0001 nucleotide binding;nucleic acid binding (.1.2) AT3G18690 39 / 0.0002 MKS1 MAP kinase substrate 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G057800 [exp] 55 / 2e-10 AT3G18690 124 / 2e-35 MAP kinase substrate 1 (.1) Potri.005G189300 [exp] 49 / 3e-08 AT1G21326 75 / 4e-16 VQ motif-containing protein (.1) Potri.015G046600 [exp] 47 / 1e-07 AT3G18360 81 / 2e-18 VQ motif-containing protein (.1) Potri.002G070600 [exp] 47 / 2e-07 AT1G21326 76 / 3e-16 VQ motif-containing protein (.1) Potri.012G055900 [exp] 43 / 4e-06 AT3G18360 73 / 2e-15 VQ motif-containing protein (.1) Potri.010G123700 [exp] 39 / 0.0001 AT1G68450 64 / 9e-13 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1) Potri.007G110100 [exp] 39 / 0.0002 AT3G18690 119 / 3e-33 MAP kinase substrate 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012286 [exp] 61 / 7e-14 AT1G21326 50 / 8e-09 VQ motif-containing protein (.1) Lus10042794 [exp] 54 / 2e-10 AT1G21326 74 / 9e-17 VQ motif-containing protein (.1) Lus10029768 [exp] 54 / 3e-10 AT1G21326 79 / 4e-18 VQ motif-containing protein (.1) Lus10009033 [exp] 53 / 2e-09 AT3G18360 110 / 5e-29 VQ motif-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05678 [poplar] [flax] VQ VQ motif
Representative CDS sequence Show only first row Show all	>Potri.006G199300.1 pacid=42768841 polypeptide=Potri.006G199300.1.p locus=Potri.006G199300 ID=Potri.006G199300.1.v4.1 annot-version=v4.1 ATGAACTCTTCAATGGCAGGAAAATTGCAGTGTCCAAGGCCAGCACCTCTTATGGTCAGCAAGAACTCGTCGAAGATCAAGAAGACGGCGGCTCCAAATC AGGGTCGTTCTTCTCCTGTTATAGTATATCTCAAATCGCCTGACATTATTCATGTGAGGCCAGAGGATTTTATGGGCACTGTTCAACGTCTTACTGGCAA AGCTGAAACTTTCTCAACTACTTCTTCATCGTCACCACCTACTTCTTGTGTTCCATGGTTGGCAGCTGATCATCACGAGACCATGAAAATGGGTATCTAG
AA sequence Show only first row Show all	>Potri.006G199300.1 pacid=42768841 polypeptide=Potri.006G199300.1.p locus=Potri.006G199300 ID=Potri.006G199300.1.v4.1 annot-version=v4.1 MNSSMAGKLQCPRPAPLMVSKNSSKIKKTAAPNQGRSSPVIVYLKSPDIIHVRPEDFMGTVQRLTGKAETFSTTSSSSPPTSCVPWLAADHHETMKMGI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G68450		PDE337	PIGMENT DEFECTIVE 337, VQ moti...		Potri.006G199300 [exp]	0	1
					Potri.007G051401 [exp]	2.00	0.8916
AT1G01490			Heavy metal transport/detoxifi...		Potri.003G132200 [exp]	7.34	0.9056
AT1G76650		CML38	calmodulin-like 38 (.1.2.3)		Potri.015G093800 [exp]	13.07	0.8668
AT1G30370		DLAH	DAD1-like acylhydrolase, alpha...		Potri.001G263200 [exp]	15.16	0.8803
AT3G21420		LBO1	LATERAL BRANCHING OXIDOREDUCTA...		Potri.010G200900 [exp]	15.49	0.8442
AT5G43066			unknown protein		Potri.014G022000 [exp]	20.14	0.8240
AT2G44890		CYP704A1	"cytochrome P450, family 704, ...		Potri.012G131200 [exp]	25.98	0.8291
AT4G24350			Phosphorylase superfamily prot...		Potri.008G028500 [exp]	26.60	0.8800
AT5G59730		ATEXO70H7	exocyst subunit exo70 family p...		Potri.009G026900 [exp]	32.24	0.8438
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.011G001500 [exp]	35.88	0.8051	CYP728D4

Compare expression of checked genes

Potri.006G199300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.