Potri.006G201400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G11780 170 / 6e-55 MD-2-related lipid recognition domain-containing protein / ML domain-containing protein (.1.2)
AT5G06480 160 / 2e-51 Immunoglobulin E-set superfamily protein (.1)
AT3G44100 134 / 5e-41 MD-2-related lipid recognition domain-containing protein (.1)
AT2G16005 73 / 1e-16 MD-2-related lipid recognition domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G067800 218 / 8e-74 AT3G11780 156 / 1e-49 MD-2-related lipid recognition domain-containing protein / ML domain-containing protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013596 162 / 6e-52 AT3G11780 181 / 2e-59 MD-2-related lipid recognition domain-containing protein / ML domain-containing protein (.1.2)
Lus10021256 159 / 8e-51 AT3G11780 183 / 4e-60 MD-2-related lipid recognition domain-containing protein / ML domain-containing protein (.1.2)
Lus10013366 151 / 2e-47 AT3G11780 161 / 1e-51 MD-2-related lipid recognition domain-containing protein / ML domain-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0532 LIG PF02221 E1_DerP2_DerF2 ML domain
Representative CDS sequence
>Potri.006G201400.1 pacid=42767578 polypeptide=Potri.006G201400.1.p locus=Potri.006G201400 ID=Potri.006G201400.1.v4.1 annot-version=v4.1
ATGGCTCACTGCATGATGATTGTTCCTTTGCTTATCTCGCTTTGTCTGATCCTACCTTTGATTCAAGCCTCCAAATTCCAGTACTGCGATAATAACAAGG
ATTATGACGTTAAAGTTAGCGGAGTGAAGATAAGCCCAAATCCGGTGAAGAAAGGGAAACCAGCGACCTTCACTATCTCTGCAACAACAAGTGAATCAAT
AACTGATGGGAAAATGAGGGTCGATGTTAGATACTTCGGATTTCCTGTGTATAGTCAGGATCATGATCTTTGCGAGGAAACGCCCTGCCCTGTAACCAGT
GGTAATTTTGTGGTGTCTCACACTGAAGAGTTGCCTGGGTTCACTCCACCTGGTTCATACTCTCTTACTATGAAGATGATTAATGGAGAAAGTCGTGAAC
TTACATGCATTTCCTTTGGTTTTCGCATTGGTTCTGCATCATCCGTTTCTGACGTTTAG
AA sequence
>Potri.006G201400.1 pacid=42767578 polypeptide=Potri.006G201400.1.p locus=Potri.006G201400 ID=Potri.006G201400.1.v4.1 annot-version=v4.1
MAHCMMIVPLLISLCLILPLIQASKFQYCDNNKDYDVKVSGVKISPNPVKKGKPATFTISATTSESITDGKMRVDVRYFGFPVYSQDHDLCEETPCPVTS
GNFVVSHTEELPGFTPPGSYSLTMKMINGESRELTCISFGFRIGSASSVSDV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G11780 MD-2-related lipid recognition... Potri.006G201400 0 1
AT3G25040 ERD2B endoplasmic reticulum retentio... Potri.001G315800 1.73 0.9440
AT1G02130 ARA5, AtRABD2a,... ARABIDOPSIS THALIANA RAB D2A, ... Potri.001G080400 3.87 0.9320
AT5G63400 ADK1 adenylate kinase 1 (.1.2) Potri.012G095300 8.66 0.9262
AT4G11150 TUFF, EMB2448, ... embryo defective 2448, vacuola... Potri.019G029200 12.96 0.9279 VATE.1
AT4G12590 Protein of unknown function DU... Potri.016G013100 13.74 0.9080
AT2G44610 RAB6, AtRABH1b,... Ras-related small GTP-binding ... Potri.003G086700 16.61 0.8890
AT3G07680 emp24/gp25L/p24 family/GOLD fa... Potri.001G369000 18.02 0.9044
AT2G16595 Translocon-associated protein ... Potri.004G168500 18.16 0.9252
AT3G25040 ERD2B endoplasmic reticulum retentio... Potri.017G056000 18.49 0.9103
AT5G01650 Tautomerase/MIF superfamily pr... Potri.006G104500 18.76 0.9111

Potri.006G201400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.