Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35910 121 / 6e-35 RING/U-box superfamily protein (.1) AT5G06490 112 / 3e-31 RING/U-box superfamily protein (.1) AT2G25409 87 / 5e-22 unknown protein AT5G27420 90 / 1e-21 CNI1, ATL31 carbon/nitrogen insensitive 1 (.1) AT2G34990 88 / 3e-21 RING/U-box superfamily protein (.1) AT2G25410 86 / 3e-20 RING/U-box superfamily protein (.1) AT3G05200 86 / 3e-20 ATL6 RING/U-box superfamily protein (.1) AT4G40070 86 / 4e-20 RING/U-box superfamily protein (.1) AT4G09120 83 / 3e-19 RING/U-box superfamily protein (.1) AT2G46160 81 / 5e-19 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G067900 [exp] 207 / 2e-69 AT2G35910 129 / 7e-38 RING/U-box superfamily protein (.1) Potri.010G243400 [exp] 129 / 2e-38 AT2G35910 152 / 4e-47 RING/U-box superfamily protein (.1) Potri.010G243200 [exp] 118 / 3e-34 AT5G06490 138 / 2e-41 RING/U-box superfamily protein (.1) Potri.008G019000 [exp] 115 / 4e-33 AT5G06490 131 / 8e-39 RING/U-box superfamily protein (.1) Potri.008G018900 [exp] 114 / 5e-33 AT2G35910 100 / 2e-26 RING/U-box superfamily protein (.1) Potri.010G243500 [exp] 107 / 7e-30 AT5G06490 113 / 6e-32 RING/U-box superfamily protein (.1) Potri.010G243300 [exp] 102 / 5e-28 AT2G35910 115 / 2e-32 RING/U-box superfamily protein (.1) Potri.014G091000 [exp] 87 / 1e-21 AT3G61550 176 / 1e-55 RING/U-box superfamily protein (.1) Potri.002G165200 [exp] 85 / 7e-21 AT3G61550 204 / 5e-67 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041079 [exp] 92 / 3e-23 AT3G61550 239 / 1e-80 RING/U-box superfamily protein (.1) Lus10031515 [exp] 86 / 2e-20 AT3G05200 232 / 1e-73 RING/U-box superfamily protein (.1) Lus10015167 [exp] 86 / 3e-20 AT3G05200 226 / 2e-71 RING/U-box superfamily protein (.1) Lus10000333 [exp] 86 / 5e-20 AT3G05200 309 / 2e-102 RING/U-box superfamily protein (.1) Lus10004460 [exp] 84 / 3e-19 AT3G05200 307 / 6e-102 RING/U-box superfamily protein (.1) Lus10024124 [exp] 81 / 3e-19 AT5G07040 190 / 2e-62 RING/U-box superfamily protein (.1) Lus10041134 [exp] 83 / 5e-19 AT1G72200 182 / 3e-54 RING/U-box superfamily protein (.1) Lus10036466 [exp] 83 / 6e-19 AT1G72200 186 / 6e-55 RING/U-box superfamily protein (.1) Lus10005389 [exp] 78 / 1e-18 AT5G07040 154 / 9e-49 RING/U-box superfamily protein (.1) Lus10029794 [exp] 81 / 3e-18 AT1G72200 219 / 1e-66 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.006G201500.1 pacid=42767831 polypeptide=Potri.006G201500.1.p locus=Potri.006G201500 ID=Potri.006G201500.1.v4.1 annot-version=v4.1 ATGAATAGCACAGCAGGGGATTCTGGATTTCTTGGCTCTAACAACATTGGTGGATTTGGCTATGGCATCGGTATCTCTATTGGAATCCTGCTGCTGATTA CAACAATCACTTTGACTTCCTATTTTTGCACGCGAAACCAACTGGCATCGGTGCCAACCCAAGCAAGAAATGTTGCAGATCAGCAGCTGAACCTGCAGAA CTTTGTCGTCGATATAGGGCTTGATGAGGCCACTCTAAATAGCTATCCTACACTGCTGTATTCGGAGGCCAAGCTACACAAGACAGGCTCCACTGCTACA TGCTGCTCCATATGTTTGGCAGATTACAAGAACACTGATAAGCTCCGGTTGCTGCCTGATTGCGGGCATCTCTTTCACCTCAGATGCGTTGACCCGTGGT TGAGGCTGCACCCAACTTGTCCGGTCTGTAGAACATCTCCATTGCCTTCACCTCTAGCGACCCCTCTGGCTGAGGTGGTTCCACTGGCAAGCAGGCGGGA TTGA
AA sequence Show only first row Show all	>Potri.006G201500.1 pacid=42767831 polypeptide=Potri.006G201500.1.p locus=Potri.006G201500 ID=Potri.006G201500.1.v4.1 annot-version=v4.1 MNSTAGDSGFLGSNNIGGFGYGIGISIGILLLITTITLTSYFCTRNQLASVPTQARNVADQQLNLQNFVVDIGLDEATLNSYPTLLYSEAKLHKTGSTAT CCSICLADYKNTDKLRLLPDCGHLFHLRCVDPWLRLHPTCPVCRTSPLPSPLATPLAEVVPLASRRD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G35910			RING/U-box superfamily protein...		Potri.006G201500 [exp]	0	1
AT2G35910			RING/U-box superfamily protein...		Potri.016G067900 [exp]	1.00	0.8862
AT4G08810		SUB1	calcium ion binding (.1)		Potri.003G219200 [exp]	2.00	0.8617
AT1G18010			Major facilitator superfamily ...		Potri.012G011000 [exp]	6.32	0.8532
AT1G15670			Galactose oxidase/kelch repeat...		Potri.001G178500 [exp]	12.96	0.8223
AT1G71530			Protein kinase superfamily pro...		Potri.013G100100 [exp]	15.55	0.7928
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Potri.001G065900 [exp]	16.70	0.8191
AT1G03820			unknown protein		Potri.007G137001 [exp]	18.65	0.8573
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Potri.006G249500 [exp]	19.36	0.7870
AT1G77330			2-oxoglutarate (2OG) and Fe(II...		Potri.005G182700 [exp]	20.49	0.8083	ACO4
AT1G61730	GeBP		DNA-binding storekeeper protei...		Potri.007G119800 [exp]	21.90	0.8041

Compare expression of checked genes

Potri.006G201500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.