Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SYP121.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11820 411 / 7e-145 PEN1, AT-SYR1, ATSYR1, ATSYP121, SYP121 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) AT3G52400 363 / 9e-126 ATSYP122, SYP122 syntaxin of plants 122 (.1) AT1G11250 346 / 8e-120 ATSYP125, SYP125 syntaxin of plants 125 (.1) AT1G61290 345 / 1e-119 ATSYP124, SYP124 syntaxin of plants 124 (.1) AT4G03330 303 / 7e-103 ATSYP123, SYP123 syntaxin of plants 123 (.1) AT3G03800 239 / 8e-78 ATSYP131, SYP131 syntaxin of plants 131 (.1) AT1G08560 232 / 8e-75 KN, ATSYP111, SYP111 KNOLLE, syntaxin of plants 111 (.1) AT5G08080 228 / 2e-73 ATSYP132, SYP132 syntaxin of plants 132 (.1.2.3) AT2G18260 160 / 4e-47 ATSYP112, SYP112 syntaxin of plants 112 (.1) AT5G16830 59 / 9e-10 ATSYP21, ATPEP12, SYP21, PEP12P syntaxin of plants 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G068600 [exp] 485 / 8e-175 AT3G11820 421 / 5e-149 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Potri.011G043700 [exp] 338 / 1e-116 AT1G61290 456 / 3e-163 syntaxin of plants 124 (.1) Potri.004G035400 [exp] 335 / 2e-115 AT1G61290 490 / 8e-177 syntaxin of plants 124 (.1) Potri.013G053200 [exp] 265 / 8e-88 AT1G08560 430 / 8e-153 KNOLLE, syntaxin of plants 111 (.1) Potri.019G030800 [exp] 261 / 3e-86 AT1G08560 431 / 3e-153 KNOLLE, syntaxin of plants 111 (.1) Potri.019G036700 [exp] 241 / 1e-78 AT3G03800 391 / 1e-137 syntaxin of plants 131 (.1) Potri.007G123000 [exp] 211 / 8e-66 AT3G03800 300 / 1e-100 syntaxin of plants 131 (.1) Potri.007G023100 [exp] 176 / 2e-53 AT2G18260 352 / 3e-122 syntaxin of plants 112 (.1) Potri.009G117900 [exp] 166 / 8e-50 AT2G18260 298 / 4e-101 syntaxin of plants 112 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021263 [exp] 460 / 6e-164 AT3G11820 436 / 3e-154 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Lus10016173 [exp] 437 / 5e-155 AT3G11820 432 / 2e-152 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Lus10013589 [exp] 426 / 4e-151 AT3G11820 437 / 2e-155 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Lus10029373 [exp] 407 / 1e-143 AT3G11820 441 / 4e-157 PENETRATION1, SYNTAXIN RELATED PROTEIN 1, syntaxin of plants 121 (.1.2) Lus10018441 [exp] 335 / 2e-115 AT1G61290 491 / 4e-177 syntaxin of plants 124 (.1) Lus10011244 [exp] 331 / 9e-114 AT1G61290 487 / 2e-175 syntaxin of plants 124 (.1) Lus10006735 [exp] 327 / 3e-112 AT1G61290 491 / 3e-177 syntaxin of plants 124 (.1) Lus10020089 [exp] 324 / 4e-110 AT1G61290 467 / 2e-166 syntaxin of plants 124 (.1) Lus10042527 [exp] 246 / 4e-80 AT1G08560 391 / 2e-137 KNOLLE, syntaxin of plants 111 (.1) Lus10021988 [exp] 245 / 5e-80 AT1G08560 388 / 2e-136 KNOLLE, syntaxin of plants 111 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0445 [poplar] [flax] SNARE-fusion PF00804 [poplar] [flax] Syntaxin Syntaxin CL0445 [poplar] [flax] PF05739 [poplar] [flax] SNARE SNARE domain
Representative CDS sequence Show only first row Show all	>Potri.006G202200.1 pacid=42770564 polypeptide=Potri.006G202200.1.p locus=Potri.006G202200 ID=Potri.006G202200.1.v4.1 annot-version=v4.1 ATGAATGACCTCTTTTCCGGCTCCTTCTCTCGCTTCCACAGCGAAGAAGCCTCCCCGGATCACCATGTAATTCAGATGTCCGAAGCGCAGTCCACCGGCG GTGGGGTTAACCTTGACAAGTTCTTTGAAGATGTAGAGTCGATCAAAGATGAGCTCAAGGAGTTGGAAAGACTTAATGAGAATATGCGGTCTTCACATGA GCAAAGTAAGACTCTGCACAACGCGAGGGCTGTCAAGGACATGAGGTCCAAGATGGATGCTGATGTTGCTCTGGCGTTGAAAAGGGCAAAGCTGATCAAG GTCCGGTTAGAGGCCTTGGACCGGTCTAATGCAGCGAACCGGAGTCTTCCTGGGTGTGGACCGGGGTCTTCTTCGGATAGGACTAGGACTTCGGTGGTGA GTGGGTTGAGGAAGAAGTTGAAGGATTTGATGGAGAGTTTTAATGGGTTGAGACAGAAGATAACCACGGAGTATAGAGAGACTGTGGAGAGAAGGTATTT TACTGTGACTGGTGAAAATCCTGATGAGAAGACTCTTGATCTGTTGATCTCTACAGGTGAGAGTGAGACATTTCTCCAGAAAGCAATTCAACAACAGGGG AGAGGCAGGATTTTGGACACGATAAATGAAATTCAGGAAAGGCATGATGCTGTGAAAGATTTGGAAAACAATCTAAAGGAGCTTCACCAAGTGTTTATGG ACATGGCAGTATTGGTTGAACATCAAGGCGAACAATTGGATGACATTGAGAGCCATGTGCAAAGAGCTAATTCTTATGTGCGGGGCGGCACCCAGCAGCT GCAGACTGCCAGGAAACTACAGAGAAATTCCAGGAAATGGACTTGTTATGCCATTATTATATTGCTGATCATCATATTGGTGGTGCTCCTCTCTGTGCGG CCGTGGGAGAAAAAGAAGTGA
AA sequence Show only first row Show all	>Potri.006G202200.1 pacid=42770564 polypeptide=Potri.006G202200.1.p locus=Potri.006G202200 ID=Potri.006G202200.1.v4.1 annot-version=v4.1 MNDLFSGSFSRFHSEEASPDHHVIQMSEAQSTGGGVNLDKFFEDVESIKDELKELERLNENMRSSHEQSKTLHNARAVKDMRSKMDADVALALKRAKLIK VRLEALDRSNAANRSLPGCGPGSSSDRTRTSVVSGLRKKLKDLMESFNGLRQKITTEYRETVERRYFTVTGENPDEKTLDLLISTGESETFLQKAIQQQG RGRILDTINEIQERHDAVKDLENNLKELHQVFMDMAVLVEHQGEQLDDIESHVQRANSYVRGGTQQLQTARKLQRNSRKWTCYAIIILLIIILVVLLSVR PWEKKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G11820		PEN1, AT-SYR1, ...	PENETRATION1, SYNTAXIN RELATED...		Potri.006G202200 [exp]	0	1	SYP121.2
AT1G53050			Protein kinase superfamily pro...		Potri.013G130000 [exp]	1.00	0.9295
AT2G30020			Protein phosphatase 2C family ...		Potri.009G073000 [exp]	2.23	0.8938	Pt-MP2.9
AT1G35710			Protein kinase family protein ...		Potri.014G195100 [exp]	3.00	0.9044
AT3G12740		ALIS1	ALA-interacting subunit 1 (.1)		Potri.008G082100 [exp]	5.09	0.9064
AT1G20780		ATPUB44, SAUL1	ARABIDOPSIS THALIANA PLANT U-B...		Potri.010G079200 [exp]	5.91	0.8930
AT3G50950		ZAR1	HOPZ-ACTIVATED RESISTANCE 1 (....		Potri.005G119800 [exp]	8.48	0.9000	RPP13.1
AT3G62220			Protein kinase superfamily pro...		Potri.002G188600 [exp]	10.44	0.8125
AT5G57580			Calmodulin-binding protein (.1...		Potri.011G043300 [exp]	11.31	0.8930	CBP60.12
AT2G17705			unknown protein		Potri.005G107700 [exp]	11.53	0.8686
AT3G45640		ATMAPK3, ATMPK3	mitogen-activated protein kina...		Potri.009G066100 [exp]	11.74	0.8938	Pt-MPK3.2

Compare expression of checked genes

Potri.006G202200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.