Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RPL27.4
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70600 238 / 5e-82 Ribosomal protein L18e/L15 superfamily protein (.1) AT1G23290 231 / 2e-79 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1) AT1G12960 107 / 4e-31 Ribosomal protein L18e/L15 superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G187000 [exp] 260 / 6e-91 AT1G70600 238 / 3e-82 Ribosomal protein L18e/L15 superfamily protein (.1) Potri.016G069000 [exp] 259 / 2e-90 AT1G70600 268 / 7e-94 Ribosomal protein L18e/L15 superfamily protein (.1) Potri.010G045800 [exp] 259 / 2e-90 AT1G70600 237 / 1e-81 Ribosomal protein L18e/L15 superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039528 [exp] 249 / 1e-86 AT1G70600 264 / 2e-92 Ribosomal protein L18e/L15 superfamily protein (.1) Lus10024161 [exp] 248 / 8e-86 AT1G70600 263 / 6e-92 Ribosomal protein L18e/L15 superfamily protein (.1) Lus10036855 [exp] 242 / 2e-83 AT1G70600 255 / 8e-89 Ribosomal protein L18e/L15 superfamily protein (.1) Lus10006207 [exp] 242 / 2e-83 AT1G70600 254 / 1e-88 Ribosomal protein L18e/L15 superfamily protein (.1) Lus10004617 [exp] 241 / 3e-83 AT1G23290 258 / 5e-90 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1) Lus10026698 [exp] 238 / 3e-82 AT1G23290 256 / 2e-89 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1) Lus10016336 [exp] 238 / 5e-82 AT1G23290 253 / 3e-88 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0588 [poplar] [flax] Ribos_L15p_L18e PF00828 [poplar] [flax] Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Representative CDS sequence Show only first row Show all	>Potri.006G202300.1 pacid=42768385 polypeptide=Potri.006G202300.1.p locus=Potri.006G202300 ID=Potri.006G202300.1.v4.1 annot-version=v4.1 ATGACTACACGCTTCAAGAAGAACAGGAAGAAGAGAGGTCACGTGAGCGCAGGTCATGGTCGGATTGGAAAGCACAGGAAGCACCCTGGAGGTCGTGGAA ATGCAGGAGGCATGCACCACCACAGGATCCTCTTCGACAAATACCATCCTGGTTACTTCGGTAAGGTTGGTATGCGGTACTTCCACAAGCTCCGCAACAA GTTCTACTGTCCCATCGTCAACATCGACAAGCTCTGGTCCATGGTCCCCCAAGATGTCAAAGACAAGGCAACCAAGGATACTGTGCCCATGATTGATGTC ACTCAGTTCGGTTACTTCAAGGTACTTGGCAAGGGGGTTTTACCTGACAAGCAACCCATTGTTGTCAAGGCCAAGCTTATTTCAAAGATTGCTGAGAAGA AGATTAAAGAGGCTGGTGGTGCTGTTGTACTTACAGCCTAG
AA sequence Show only first row Show all	>Potri.006G202300.1 pacid=42768385 polypeptide=Potri.006G202300.1.p locus=Potri.006G202300 ID=Potri.006G202300.1.v4.1 annot-version=v4.1 MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFYCPIVNIDKLWSMVPQDVKDKATKDTVPMIDV TQFGYFKVLGKGVLPDKQPIVVKAKLISKIAEKKIKEAGGAVVLTA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G70600			Ribosomal protein L18e/L15 sup...		Potri.006G202300 [exp]	0	1	Pt-RPL27.4
AT2G42740		RPL16A	ribosomal protein large subuni...		Potri.011G069200 [exp]	1.41	0.9742	L16.2
AT2G47110		UBQ6	ubiquitin 6 (.1.2)		Potri.015G111500 [exp]	1.73	0.9698	Pt-UBI.4
AT1G70600			Ribosomal protein L18e/L15 sup...		Potri.010G045800 [exp]	2.23	0.9618
AT5G04800			Ribosomal S17 family protein (...		Potri.010G241200 [exp]	3.46	0.9698
AT1G73230			Nascent polypeptide-associated...		Potri.017G141100 [exp]	4.47	0.9523
AT5G09500			Ribosomal protein S19 family p...		Potri.005G219700 [exp]	7.21	0.9644
AT5G48760			Ribosomal protein L13 family p...		Potri.017G054600 [exp]	8.48	0.9513	RPL13.2
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Potri.012G024300 [exp]	10.19	0.9510	Pt-UBQ1.2
AT2G09990			Ribosomal protein S5 domain 2-...		Potri.010G091000 [exp]	10.24	0.9363
AT4G15000			Ribosomal L27e protein family ...		Potri.016G019000 [exp]	10.58	0.9488	RPL27.1

Compare expression of checked genes

Potri.006G202300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.