Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11660 267 / 9e-92 NHL1 NDR1/HIN1-like 1 (.1) AT3G52470 256 / 2e-87 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35960 241 / 2e-81 NHL12 NDR1/HIN1-like 12 (.1) AT3G44220 228 / 3e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G06330 226 / 1e-75 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35970 207 / 7e-68 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G22200 205 / 4e-67 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G09590 203 / 2e-66 NHL22 NDR1/HIN1-like 22 (.1) AT5G53730 130 / 6e-38 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G01410 118 / 8e-33 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G071500 [exp] 307 / 2e-107 AT3G11660 272 / 1e-93 NDR1/HIN1-like 1 (.1) Potri.009G019600 [exp] 222 / 6e-74 AT3G44220 242 / 8e-82 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.005G088000 [exp] 170 / 2e-53 AT3G44220 194 / 5e-63 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G006000 [exp] 143 / 9e-43 AT5G53730 225 / 4e-75 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.015G002400 [exp] 137 / 1e-40 AT5G53730 227 / 7e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.014G106100 [exp] 112 / 6e-31 AT4G01410 185 / 7e-59 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.002G180000 [exp] 110 / 2e-30 AT4G01410 232 / 9e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G145500 [exp] 71 / 1e-14 AT5G36970 238 / 2e-78 NDR1/HIN1-like 25 (.1) Potri.006G204300 [exp] 69 / 2e-14 AT2G35980 208 / 6e-68 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021286 [exp] 280 / 2e-96 AT3G52470 298 / 1e-103 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016960 [exp] 275 / 8e-95 AT3G11660 295 / 1e-102 NDR1/HIN1-like 1 (.1) Lus10004202 [exp] 222 / 6e-74 AT3G11660 257 / 8e-88 NDR1/HIN1-like 1 (.1) Lus10029406 [exp] 216 / 2e-71 AT3G11660 252 / 7e-86 NDR1/HIN1-like 1 (.1) Lus10043410 [exp] 177 / 5e-56 AT3G44220 207 / 6e-68 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10034175 [exp] 166 / 1e-51 AT3G44220 210 / 7e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10000157 [exp] 156 / 5e-48 AT3G52470 164 / 3e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10013327 [exp] 130 / 2e-37 AT3G11660 147 / 2e-44 NDR1/HIN1-like 1 (.1) Lus10032932 [exp] 118 / 5e-33 AT5G53730 211 / 4e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10030193 [exp] 98 / 1e-24 AT4G01410 185 / 3e-58 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.006G204200.1 pacid=42768905 polypeptide=Potri.006G204200.1.p locus=Potri.006G204200 ID=Potri.006G204200.1.v4.1 annot-version=v4.1 ATGACATCCAAGAAAGACTGCGGCCACCACGGCCAAAAACGCCGAAGACTCGTCCGCCTGTTATTCGCCGGAATCCTAACCTTCCTCCTCATTGCCCTCA TCATAATCCTCATAGTTTGGGCCATCCTCCGTCCTTCAAAACCAAAATTCATCCTCCAAGATGCTACAGTTTACGCCTTTAACGTTTCATATCCAAACTT CATCACTTCCAACTTCCAAGTCACCGTATCCTCTCGCAACCCGGATGATAGAGTCGGAATCTACTATGATAGACTCGATATATATGCCACATACCGTAAC CAACAAATAACTCTACGAACTTCCATACCTACTTCTTACCAAGGACACAAAGAGATTAATGTTTGGTCCCCTTTTATTTACGGCAACTCCGTGCCGGTAT CTCCGTACAATTCAGCTGCATTAAGTCAAGACCAAGGTGCAGGAGTTGTGATGCTGATGATCAAGATTGATGGTCGTGTTCGATTCAAAGTCGGAACCTT TATTTCTGCGAAATACAATTTGCATGTTAGGTGTCCTGCTTATATTCAGTTTGGTAGCAGAACTAATGGAATTATGGTCGGTGACAACGTCGTTAAGTAT CAGCTGGCAACGAGTTGCCATGTAAGCCTCTGA
AA sequence Show only first row Show all	>Potri.006G204200.1 pacid=42768905 polypeptide=Potri.006G204200.1.p locus=Potri.006G204200 ID=Potri.006G204200.1.v4.1 annot-version=v4.1 MTSKKDCGHHGQKRRRLVRLLFAGILTFLLIALIIILIVWAILRPSKPKFILQDATVYAFNVSYPNFITSNFQVTVSSRNPDDRVGIYYDRLDIYATYRN QQITLRTSIPTSYQGHKEINVWSPFIYGNSVPVSPYNSAALSQDQGAGVVMLMIKIDGRVRFKVGTFISAKYNLHVRCPAYIQFGSRTNGIMVGDNVVKY QLATSCHVSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G11660		NHL1	NDR1/HIN1-like 1 (.1)		Potri.006G204200 [exp]	0	1
AT2G38080		ATLMCO4, IRX12,...	LACCASE 4, IRREGULAR XYLEM 12,...		Potri.009G042500 [exp]	6.00	0.6763
AT2G47680	C3HZnF		zinc finger (CCCH type) helica...		Potri.017G031800 [exp]	9.32	0.6875
AT3G15760			unknown protein		Potri.018G131100 [exp]	15.55	0.6575
AT2G38430			unknown protein		Potri.019G030300 [exp]	20.39	0.6190
AT1G05460		SDE3	SILENCING DEFECTIVE, P-loop co...		Potri.007G074070 [exp]	21.95	0.6937
AT5G06700		TBR	TRICHOME BIREFRINGENCE, Plant ...		Potri.016G059300 [exp]	31.46	0.6653
					Potri.001G434600 [exp]	40.89	0.6631
AT1G14790		ATRDRP1, RDR1	RNA-dependent RNA polymerase 1...		Potri.008G135800 [exp]	43.41	0.6396
AT3G15040			Protein of unknown function, D...		Potri.016G076300 [exp]	61.70	0.5525
AT1G19220	ARF	IAA22, ARF11, A...	indole-3-acetic acid inducible...		Potri.018G145800 [exp]	61.84	0.5855	Pt-CSARF2.3

Compare expression of checked genes

Potri.006G204200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.