Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	B13.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35980 208 / 7e-68 NHL10, YLS9, ATNHL10 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11650 178 / 6e-56 NHL2 NDR1/HIN1-like 2 (.1) AT5G06320 174 / 9e-55 NHL3 NDR1/HIN1-like 3 (.1) AT2G35460 150 / 3e-45 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT1G32270 113 / 2e-29 ATSYP24 SYNTAXIN 24, syntaxin, putative (.1) AT3G52470 76 / 1e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G06330 75 / 2e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G05220 74 / 9e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11660 71 / 6e-15 NHL1 NDR1/HIN1-like 1 (.1) AT2G35970 70 / 1e-14 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G071600 [exp] 335 / 3e-118 AT2G35980 205 / 9e-67 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G145500 [exp] 77 / 8e-17 AT5G36970 238 / 2e-78 NDR1/HIN1-like 25 (.1) Potri.016G071500 [exp] 75 / 1e-16 AT3G11660 272 / 1e-93 NDR1/HIN1-like 1 (.1) Potri.015G148200 [exp] 76 / 3e-16 AT5G36970 227 / 2e-74 NDR1/HIN1-like 25 (.1) Potri.009G158900 [exp] 73 / 3e-15 AT2G27080 259 / 8e-87 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.003G039400 [exp] 72 / 8e-15 AT1G17620 208 / 1e-66 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.011G027400 [exp] 70 / 1e-14 AT4G05220 264 / 8e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G204200 [exp] 70 / 2e-14 AT3G11660 267 / 1e-91 NDR1/HIN1-like 1 (.1) Potri.009G003800 [exp] 69 / 2e-14 AT5G22870 179 / 4e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021287 [exp] 228 / 9e-76 AT2G35980 236 / 7e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021288 [exp] 226 / 4e-75 AT2G35980 237 / 2e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016962 [exp] 207 / 1e-67 AT2G35980 237 / 3e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021286 [exp] 77 / 3e-17 AT3G52470 298 / 1e-103 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10034173 [exp] 77 / 6e-17 AT2G27260 149 / 2e-44 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10043411 [exp] 77 / 1e-16 AT2G27260 148 / 6e-44 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016960 [exp] 74 / 5e-16 AT3G11660 295 / 1e-102 NDR1/HIN1-like 1 (.1) Lus10037638 [exp] 75 / 6e-16 AT1G17620 201 / 4e-64 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10020783 [exp] 74 / 1e-15 AT5G36970 229 / 2e-75 NDR1/HIN1-like 25 (.1) Lus10015622 [exp] 74 / 2e-15 AT1G17620 196 / 5e-62 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.006G204300.1 pacid=42769943 polypeptide=Potri.006G204300.1.p locus=Potri.006G204300 ID=Potri.006G204300.1.v4.1 annot-version=v4.1 ATGGCAGAGAAACAAGCTCACTTGAATGGCGCCTCTTACGGTCCATCAATCCCACCTCCGCAACACTACCACCGCCCTGGCCGTGGTTCTGACCGTGGCT GCTGCTGTTTCTTGGCCTTCCTCCTCAAAGTCATCATCACCGTGGCCATGCTTATTGGGCTTTTCATCCTTATTATCTGGCTCATATTTCGTCCCATTAA CAAGGTCGAATTCCATGTCACAGACGTTGCTTTAACTCAGTTCAACTACACCAACAACATGCTCCAATTCAACCTTGCTGCCAACATCAGTATCCGCAAC CCTAACAAAAAGATTGGGATTTACTATGATAGGATAGAGGCCAGGGCATTTTATGAGGACCAGAGGTTTGGCTATCATGCCTTGACTCCATTCTATCAAG GACACAAGAACACAAGTGTCTTGAACGTAGTTTTTAAAGGGCAGCAAGCAGTTACCCTTCAAGGTGAAGAGTTGACACGGTTTAATCAAGAAAGAACAAG TGGGTTATATAGTATTGCCTTGGAGTTGTCTTTGAGGATTAGATTTAAGCTTGGTAAGGTCAAGACTGCAAGGTTCAAGCCCAAGGTTGAGTGTGACGAT TTGAAGATTCCTCTGAACGGATCTCCTGTTGCTGGGAGTAATAACAAGTGCGAGATCAAGTTTTGA
AA sequence Show only first row Show all	>Potri.006G204300.1 pacid=42769943 polypeptide=Potri.006G204300.1.p locus=Potri.006G204300 ID=Potri.006G204300.1.v4.1 annot-version=v4.1 MAEKQAHLNGASYGPSIPPPQHYHRPGRGSDRGCCCFLAFLLKVIITVAMLIGLFILIIWLIFRPINKVEFHVTDVALTQFNYTNNMLQFNLAANISIRN PNKKIGIYYDRIEARAFYEDQRFGYHALTPFYQGHKNTSVLNVVFKGQQAVTLQGEELTRFNQERTSGLYSIALELSLRIRFKLGKVKTARFKPKVECDD LKIPLNGSPVAGSNNKCEIKF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G35980		NHL10, YLS9, AT...	YELLOW-LEAF-SPECIFIC GENE 9, A...		Potri.006G204300 [exp]	0	1	B13.1
AT5G48150	GRAS	PAT1	phytochrome a signal transduct...		Potri.001G409500 [exp]	3.46	0.9318
AT3G25730	AP2_ERF	EDF3	ethylene response DNA binding ...		Potri.004G220550 [exp]	3.46	0.9399
AT2G17290		ATCPK6, ATCDPK3...	calcium dependent protein kina...		Potri.009G168600 [exp]	4.00	0.8907	CDPK3.2
AT3G25730	AP2_ERF	EDF3	ethylene response DNA binding ...		Potri.004G220400 [exp]	4.47	0.9371
AT2G24300			Calmodulin-binding protein (.1...		Potri.006G187900 [exp]	4.69	0.9044	CBP60.9
AT5G54490		PBP1	pinoid-binding protein 1 (.1)		Potri.013G151000 [exp]	6.48	0.9255
AT1G49850			RING/U-box superfamily protein...		Potri.009G091200 [exp]	6.55	0.8612
AT5G52020	AP2_ERF		Integrase-type DNA-binding sup...		Potri.012G134000 [exp]	6.70	0.9114
AT1G27200			Domain of unknown function (DU...		Potri.008G192000 [exp]	7.74	0.9051
AT3G25730	AP2_ERF	EDF3	ethylene response DNA binding ...		Potri.004G220700 [exp]	9.21	0.8886

Compare expression of checked genes

Potri.006G204300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.