Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06300 316 / 9e-111 LOG7 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) AT2G37210 283 / 1e-97 LOG3 LONELY GUY 3, lysine decarboxylase family protein (.1.2) AT2G35990 280 / 2e-96 LOG2 LONELY GUY 2, Putative lysine decarboxylase family protein (.1.2.3) AT3G53450 280 / 2e-96 LOG4 LONELY GUY 4, Putative lysine decarboxylase family protein (.1) AT2G28305 278 / 1e-95 ATLOG1 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) AT4G35190 248 / 1e-83 LOG5 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) AT5G11950 227 / 1e-75 LOG8 LONELY GUY 8, Putative lysine decarboxylase family protein (.1.2) AT5G03270 202 / 8e-66 LOG6 LONELY GUY 6, lysine decarboxylase family protein (.1) AT5G26140 149 / 3e-46 ATLOG9 LONELY GUY 9, Putative lysine decarboxylase family protein (.1) AT1G50575 47 / 4e-06 Putative lysine decarboxylase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G072000 [exp] 345 / 2e-122 AT5G06300 323 / 1e-113 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.016G090500 [exp] 285 / 2e-98 AT2G37210 392 / 8e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.006G127400 [exp] 284 / 4e-98 AT2G37210 396 / 3e-142 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.002G024000 [exp] 277 / 2e-95 AT2G37210 310 / 2e-108 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Potri.009G010800 [exp] 276 / 5e-95 AT2G28305 359 / 8e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.005G237600 [exp] 276 / 7e-95 AT5G06300 338 / 2e-119 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Potri.004G212200 [exp] 271 / 5e-93 AT2G28305 361 / 1e-128 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Potri.004G181800 [exp] 256 / 9e-87 AT4G35190 361 / 3e-128 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Potri.002G012500 [exp] 255 / 9e-87 AT4G35190 300 / 5e-104 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026513 [exp] 281 / 6e-97 AT2G37210 394 / 1e-141 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10021462 [exp] 280 / 1e-96 AT2G28305 386 / 1e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10016096 [exp] 279 / 4e-96 AT2G28305 384 / 7e-138 LONELY GUY 1, Putative lysine decarboxylase family protein (.1) Lus10012436 [exp] 277 / 2e-95 AT5G06300 332 / 7e-117 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10004222 [exp] 275 / 4e-95 AT5G06300 293 / 1e-102 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10002226 [exp] 275 / 2e-94 AT2G37210 379 / 2e-135 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10024328 [exp] 271 / 1e-92 AT5G06300 328 / 2e-115 LONELY GUY 7, Putative lysine decarboxylase family protein (.1) Lus10023190 [exp] 265 / 1e-90 AT2G37210 364 / 6e-130 LONELY GUY 3, lysine decarboxylase family protein (.1.2) Lus10003335 [exp] 260 / 2e-88 AT4G35190 359 / 2e-127 LONELY GUY 5, Putative lysine decarboxylase family protein (.1) Lus10025117 [exp] 259 / 1e-87 AT4G35190 373 / 1e-132 LONELY GUY 5, Putative lysine decarboxylase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0349 [poplar] [flax] SLOG PF03641 [poplar] [flax] Lysine_decarbox Possible lysine decarboxylase
Representative CDS sequence Show only first row Show all	>Potri.006G204800.1 pacid=42768610 polypeptide=Potri.006G204800.1.p locus=Potri.006G204800 ID=Potri.006G204800.1.v4.1 annot-version=v4.1 ATGGAGGATACTGAATCCAAGTTTAAGAGGGTTTGCGTGTTTTGTGGGAGTAGTTCAGGCAAGAAAGCCAGCTACCAGGAAGCTGCTGTTGAGTTGGCCA AGGAACTGGTTGAGAGAAGAATTGATTTGGTCTATGGAGGTGGGAGCGTGGGGTTAATGGGCCTTGTTTCTCAGGCGGTTCATGATGGTGGGCGCCATGT TCTAGGAGTTATCCCAAGGTCCCTAATGCCCAGAGAGGTAACAGGAGAGCCTGTCGGGGAGGTTAGAGCTGTATCTGATATGCATCAAAGGAAAGCTGAA ATGGCTCGCCAAGCCGATGCCTTCATTGCCCTCCCTGGGGGCTATGGGACACTAGAAGAATTACTTGAAGTAATTACATGGGCTCAACTTAATATCCATC ACAAACCTGTGGGCCTCTTGAATGTAGATGGATACTATAATTCGCTGCTGTCTTTCATTGACAAGGCCGTTGATGAAGGCTTTATATCGCCTGCCGCACG TCGCATTATCGTGTCTGCGTCCACAGCTAAACAATTGTTCAGACAGCTAGAGGATTATGTGCCAGAACATGATGAAATAACAGCCAAGTTGGTGTGGGGG GAGGTTGATGATAGACTGACCTGCGTGCCTGAATCTGGGGTTGCCTAG
AA sequence Show only first row Show all	>Potri.006G204800.1 pacid=42768610 polypeptide=Potri.006G204800.1.p locus=Potri.006G204800 ID=Potri.006G204800.1.v4.1 annot-version=v4.1 MEDTESKFKRVCVFCGSSSGKKASYQEAAVELAKELVERRIDLVYGGGSVGLMGLVSQAVHDGGRHVLGVIPRSLMPREVTGEPVGEVRAVSDMHQRKAE MARQADAFIALPGGYGTLEELLEVITWAQLNIHHKPVGLLNVDGYYNSLLSFIDKAVDEGFISPAARRIIVSASTAKQLFRQLEDYVPEHDEITAKLVWG EVDDRLTCVPESGVA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G06300		LOG7	LONELY GUY 7, Putative lysine ...		Potri.006G204800 [exp]	0	1
AT5G26010			Protein phosphatase 2C family ...		Potri.006G232700 [exp]	6.92	0.6400
AT4G08330			unknown protein		Potri.005G178000 [exp]	10.90	0.6756
AT3G24110			Calcium-binding EF-hand family...		Potri.017G054902 [exp]	26.30	0.6323
AT1G03010			Phototropic-responsive NPH3 fa...		Potri.002G209700 [exp]	32.18	0.6279
AT5G03250			Phototropic-responsive NPH3 fa...		Potri.010G223600 [exp]	41.37	0.6220
AT2G42410	C2H2ZnF	ATZFP11, ZFP11	zinc finger protein 11 (.1)		Potri.002G041700 [exp]	45.82	0.6198
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Potri.009G084100 [exp]	53.89	0.5745
AT5G12250		TUB6	beta-6 tubulin (.1)		Potri.003G126800 [exp]	61.18	0.5921	TUB10
AT1G11440			unknown protein		Potri.004G029500 [exp]	65.72	0.6016
AT1G04110		SDD1	STOMATAL DENSITY AND DISTRIBUT...		Potri.019G006570 [exp]	66.13	0.5895

Compare expression of checked genes

Potri.006G204800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.