Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36020 226 / 3e-74 HVA22J HVA22-like protein J (.1) AT5G42560 202 / 2e-64 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) AT1G75700 197 / 1e-63 HVA22G HVA22-like protein G (.1) AT1G19950 191 / 2e-59 HVA22H HVA22-like protein H (ATHVA22H) (.1) AT4G36720 59 / 2e-10 HVA22K HVA22-like protein K (.1) AT4G24960 50 / 7e-08 ATHVA22D ARABIDOPSIS THALIANA HVA22 HOMOLOGUE D, HVA22 homologue D (.1.2.3) AT2G42820 50 / 1e-07 HVA22F HVA22-like protein F (.1) AT5G50720 49 / 1e-07 ATHVA22E ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) AT1G74520 46 / 4e-06 ATHVA22A HVA22 homologue A (.1) AT1G69700 45 / 8e-06 ATHVA22C HVA22 homologue C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G072600 [exp] 309 / 8e-108 AT2G36020 210 / 9e-69 HVA22-like protein J (.1) Potri.002G023500 [exp] 216 / 1e-69 AT5G42560 296 / 2e-100 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Potri.005G237900 [exp] 215 / 3e-69 AT5G42560 274 / 1e-91 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Potri.004G166800 [exp] 212 / 2e-68 AT1G75700 234 / 3e-78 HVA22-like protein G (.1) Potri.009G113400 [exp] 68 / 1e-13 AT4G36720 241 / 1e-81 HVA22-like protein K (.1) Potri.007G029300 [exp] 66 / 1e-12 AT4G36720 252 / 2e-85 HVA22-like protein K (.1) Potri.014G148600 [exp] 50 / 9e-08 AT5G62490 87 / 1e-22 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) Potri.015G062800 [exp] 49 / 6e-07 AT1G74520 255 / 4e-88 HVA22 homologue A (.1) Potri.012G069300 [exp] 48 / 1e-06 AT1G74520 259 / 1e-89 HVA22 homologue A (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004215 [exp] 230 / 7e-77 AT2G36020 196 / 6e-64 HVA22-like protein J (.1) Lus10021299 [exp] 227 / 8e-75 AT2G36020 206 / 6e-67 HVA22-like protein J (.1) Lus10016974 [exp] 225 / 3e-74 AT2G36020 210 / 2e-68 HVA22-like protein J (.1) Lus10034519 [exp] 216 / 1e-69 AT5G42560 324 / 2e-111 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10033152 [exp] 215 / 2e-69 AT5G42560 328 / 7e-113 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10029419 [exp] 210 / 3e-68 AT2G36020 198 / 1e-63 HVA22-like protein J (.1) Lus10024332 [exp] 206 / 2e-65 AT5G42560 330 / 9e-114 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10010093 [exp] 63 / 8e-12 AT4G36720 202 / 2e-66 HVA22-like protein K (.1) Lus10007215 [exp] 61 / 3e-11 AT4G36720 196 / 2e-64 HVA22-like protein K (.1) Lus10023605 [exp] 57 / 1e-09 AT1G74520 246 / 7e-84 HVA22 homologue A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03134 [poplar] [flax] TB2_DP1_HVA22 TB2/DP1, HVA22 family
Representative CDS sequence Show only first row Show all	>Potri.006G205300.2 pacid=42770546 polypeptide=Potri.006G205300.2.p locus=Potri.006G205300 ID=Potri.006G205300.2.v4.1 annot-version=v4.1 ATGGTAGGAGATTTCATCATCAGATTTCTTGTGTTGCTTTTTGGATATGCATACCCAGCATTTGAATGTTTCAAATCTGTGGAGAAGAACAACGTGGATA TTGAAGAAATTAGATTCTGGTGTCAATATTGGATCATTATTGCACTTGTAACGGTTTGTGAGAGGATAGGAGACATATTTCTTTCATGGTTGCCAATGTA TGGTGAAGTGAAGCTGGCATTTTTTATCTACTTATGGCATCCAAAAACAAAGGGAACTGGCTATATCTATGACACCTTGTTGAGACCTTTGGTAGCAAGG CATGAAACGGGTATCGAAAGGAAGCTACAGGAGATGAAGGCTAGAGGTTGGGACTTTGCCATCTACTACTGGAATAACTACACAGAACTGGGGCAAACTA AATTCTTTGAAGCTCTGCAATACTTGGCGAGTCAGTCAGGAAAGTTTACAAACAACAACAGTGAGAAGAGCAATGGCGATGAACCTAGTGCTACGTCTCC AAATGAGTTACCATCATTGGCCAAGAATACAAGCAAGAACTCCAAGTCGCCACCAAGACCACCGACAACGCCTGGCAGCAGCACAATCAACCGAGAAGTT GCAGGATCACAAAAATCCAAACGAGTACAAGTCCACCTCAATGAGGAAACAGAATCTGTTACCGCAATGGACACGGACAACTCAACTAACCTTGATCCTA ATGTCAATGAAAAGCTCCACCAATTTCGTACGAGGCTACGAAGATCAAAACCAACTCAACAATGA
AA sequence Show only first row Show all	>Potri.006G205300.2 pacid=42770546 polypeptide=Potri.006G205300.2.p locus=Potri.006G205300 ID=Potri.006G205300.2.v4.1 annot-version=v4.1 MVGDFIIRFLVLLFGYAYPAFECFKSVEKNNVDIEEIRFWCQYWIIIALVTVCERIGDIFLSWLPMYGEVKLAFFIYLWHPKTKGTGYIYDTLLRPLVAR HETGIERKLQEMKARGWDFAIYYWNNYTELGQTKFFEALQYLASQSGKFTNNNSEKSNGDEPSATSPNELPSLAKNTSKNSKSPPRPPTTPGSSTINREV AGSQKSKRVQVHLNEETESVTAMDTDNSTNLDPNVNEKLHQFRTRLRRSKPTQQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G36020		HVA22J	HVA22-like protein J (.1)		Potri.006G205300 [exp]	0	1
AT3G22400		ATLOX5, LOX5	Arabidopsis thaliana lipoxygen...		Potri.014G177200 [exp]	4.58	0.9388
AT1G75260			oxidoreductases, acting on NAD...		Potri.005G228400 [exp]	4.69	0.9319
AT4G14540	CCAAT	NF-YB3	"nuclear factor Y, subunit B3"...		Potri.007G082200 [exp]	7.14	0.8627
AT5G37790			Protein kinase superfamily pro...		Potri.004G089100 [exp]	7.93	0.8514
AT3G18670			Ankyrin repeat family protein ...		Potri.002G048832 [exp]	10.95	0.9193
AT4G35000		APX3	ascorbate peroxidase 3 (.1)		Potri.005G112200 [exp]	14.14	0.9157
AT2G27140			HSP20-like chaperones superfam...		Potri.004G191101 [exp]	17.88	0.9142
AT4G33490			Eukaryotic aspartyl protease f...		Potri.007G099301 [exp]	19.44	0.9120
					Potri.016G012450 [exp]	21.49	0.8873
AT5G37180		ATSUS5, SUS5	ARABIDOPSIS THALIANA SUCROSE S...		Potri.017G139100 [exp]	21.54	0.9058

Compare expression of checked genes

Potri.006G205300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.