Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52560 275 / 7e-97 MMZ4 ,UEV1D ,UEV1D-4 MMS2 ZWEI HOMOLOGUE 4, ubiquitin E2 variant 1D-4 (.1.2.3.4) AT2G36060 270 / 5e-95 MMZ3 ,UEV1C UBIQUITIN E2 VARIANT 1C, MMS ZWEI homologue 3 (.1.2.3) AT1G23260 219 / 9e-75 MMZ1 ,UEV1A UBIQUITIN E2 VARIANT 1A, MMS ZWEI homologue 1 (.1) AT1G70660 216 / 2e-73 MMZ2 ,UEV1B UBIQUITIN E2 VARIANT 1B, MMS ZWEI homologue 2 (.1.2) AT1G70650 212 / 1e-66 Ran BP2/NZF zinc finger-like superfamily protein (.1.2) AT5G25760 52 / 8e-09 PEX4, UBC21 ubiquitin-conjugating enzyme 21, peroxin4 (.1.2) AT2G02760 49 / 6e-08 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT1G14400 49 / 6e-08 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2) AT3G13550 49 / 1e-07 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2) AT3G46460 47 / 3e-07 UBC13 ubiquitin-conjugating enzyme 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G073100 [exp] 282 / 2e-99 AT3G52560 281 / 5e-99 MMS2 ZWEI HOMOLOGUE 4, ubiquitin E2 variant 1D-4 (.1.2.3.4) Potri.008G133900 [exp] 233 / 7e-80 AT1G23260 258 / 1e-89 UBIQUITIN E2 VARIANT 1A, MMS ZWEI homologue 1 (.1) Potri.010G107700 [exp] 233 / 8e-80 AT1G23260 269 / 5e-94 UBIQUITIN E2 VARIANT 1A, MMS ZWEI homologue 1 (.1) Potri.009G049600 [exp] 52 / 8e-09 AT3G20060 296 / 3e-104 ubiquitin-conjugating enzyme19 (.1.2) Potri.001G254500 [exp] 51 / 2e-08 AT3G20060 295 / 1e-103 ubiquitin-conjugating enzyme19 (.1.2) Potri.018G039200 [exp] 50 / 2e-08 AT5G25760 314 / 5e-112 ubiquitin-conjugating enzyme 21, peroxin4 (.1.2) Potri.006G240900 [exp] 50 / 2e-08 AT5G25760 315 / 2e-112 ubiquitin-conjugating enzyme 21, peroxin4 (.1.2) Potri.015G064000 [exp] 49 / 5e-08 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.001G089300 [exp] 49 / 1e-07 AT3G13550 256 / 3e-88 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029415 [exp] 285 / 1e-100 AT3G52560 290 / 7e-103 MMS2 ZWEI HOMOLOGUE 4, ubiquitin E2 variant 1D-4 (.1.2.3.4) Lus10004211 [exp] 265 / 9e-93 AT2G36060 273 / 8e-96 UBIQUITIN E2 VARIANT 1C, MMS ZWEI homologue 3 (.1.2.3) Lus10034611 [exp] 223 / 1e-75 AT1G23260 266 / 1e-92 UBIQUITIN E2 VARIANT 1A, MMS ZWEI homologue 1 (.1) Lus10021797 [exp] 220 / 2e-74 AT1G23260 268 / 3e-93 UBIQUITIN E2 VARIANT 1A, MMS ZWEI homologue 1 (.1) Lus10009495 [exp] 50 / 7e-08 AT5G25760 273 / 1e-93 ubiquitin-conjugating enzyme 21, peroxin4 (.1.2) Lus10016670 [exp] 49 / 1e-07 AT5G56150 149 / 1e-46 ubiquitin-conjugating enzyme 30 (.1.2) Lus10007126 [exp] 49 / 1e-07 AT3G08690 148 / 4e-46 ubiquitin-conjugating enzyme 11 (.1.2) Lus10037203 [exp] 49 / 1e-07 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10036727 [exp] 49 / 1e-07 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10030786 [exp] 48 / 2e-07 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.006G205700.2 pacid=42769813 polypeptide=Potri.006G205700.2.p locus=Potri.006G205700 ID=Potri.006G205700.2.v4.1 annot-version=v4.1 ATGACGCTTGGCTCAGGAGGATCCAGTGTCGTGGTCCCTCGGAACTTCAGATTGCTTGAGGAACTTGAACGTGGAGAAAAAGGTATTGGGGATGGCACAG TAAGCTATGGAATGGATGACGGAGATGACATTTACATGCGCTCTTGGACTGGCACTGTAATCGGTCCTCACAATACTGTACATGAAGGTCGAATTTATCA GTTAAAGCTGTTCTGTGATAAAGATTACCCGGAGAAGCCACCAAGTGTTCGCTTTCATTCTCGGATCAATATGACTTGTGTTAACCATGAAACTGGAGTG GTGGAACCAAAAAAGTTTGGACTTCTCTCAAATTGGCAGCGAGATTACACTATGGAGGACATCCTTACACAGCTGAAGAAGGAGATGACAGCACCACACA ACCGGAAGCTGGTCCAGCCTCCTGAGGGTACCTACTTCTAG
AA sequence Show only first row Show all	>Potri.006G205700.2 pacid=42769813 polypeptide=Potri.006G205700.2.p locus=Potri.006G205700 ID=Potri.006G205700.2.v4.1 annot-version=v4.1 MTLGSGGSSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDGDDIYMRSWTGTVIGPHNTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGV VEPKKFGLLSNWQRDYTMEDILTQLKKEMTAPHNRKLVQPPEGTYF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G52560		MMZ4 ,UEV1D ,UE...	MMS2 ZWEI HOMOLOGUE 4, ubiquit...		Potri.006G205700 [exp]	0	1
AT5G03460			unknown protein		Potri.006G122600 [exp]	3.87	0.7090
AT5G42190		SKP1B, ASK2	Arabidopsis SKP-like 2, E3 ubi...		Potri.002G018700 [exp]	7.61	0.7314	Pt-SKP1.2
AT5G55850		NOI	RPM1-interacting protein 4 (RI...		Potri.011G094200 [exp]	7.74	0.7224
AT5G57860			Ubiquitin-like superfamily pro...		Potri.006G181400 [exp]	12.36	0.7223
AT1G26665			Mediator complex, subunit Med1...		Potri.001G083801 [exp]	13.74	0.6310
AT1G71950			Proteinase inhibitor, propepti...		Potri.019G083300 [exp]	19.13	0.6905
					Potri.013G126000 [exp]	19.33	0.6535
AT5G49610			F-box family protein (.1)		Potri.007G027300 [exp]	19.41	0.6302
AT2G02760		ATUBC2	ubiquitin-conjugating enzyme 2...		Potri.015G064000 [exp]	19.67	0.6791
AT4G39220		ATRER1A	Rer1 family protein (.1)		Potri.009G118500 [exp]	19.79	0.6797

Compare expression of checked genes

Potri.006G205700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.