Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT2G27330 90 / 3e-24 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G73530 91 / 6e-24 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G23830 90 / 7e-24 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2) AT3G46020 89 / 7e-24 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G37510 86 / 2e-22 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G13860 85 / 2e-22 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT4G13850 86 / 4e-22 ATGRP2, GR-RBP2 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) AT1G74230 89 / 6e-22 GR-RBP5 glycine-rich RNA-binding protein 5 (.1) AT4G39260 83 / 1e-21 ATGRP8, CCR1, GR-RBP8 glycine-rich RNA-binding protein 8, GLYCINE-RICH PROTEIN 8, cold, circadian rhythm, and RNA binding 1 (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G160300 [exp] 105 / 3e-30 AT2G27330 98 / 1e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.015G057400 [exp] 98 / 8e-26 AT5G61030 157 / 8e-47 glycine-rich RNA-binding protein 3 (.1) Potri.012G061600 [exp] 96 / 5e-25 AT5G61030 181 / 9e-56 glycine-rich RNA-binding protein 3 (.1) Potri.008G022280 [exp] 92 / 8e-25 AT3G20930 203 / 2e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G038200 [exp] 91 / 6e-24 AT1G73530 141 / 6e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.008G022200 [exp] 91 / 2e-22 AT3G20930 427 / 3e-149 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G236300 [exp] 85 / 4e-22 AT4G13850 88 / 1e-23 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.004G155300 [exp] 86 / 8e-22 AT2G21660 145 / 3e-45 GLYCINE-RICH RNA-BINDING PROTEIN 7, "cold, circadian rhythm, and rna binding 2", GLYCINE RICH PROTEIN 7, cold, circadian rhythm, and rna binding 2 (.1.2) Potri.010G237200 [exp] 89 / 1e-21 AT3G20930 429 / 5e-150 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029426 [exp] 143 / 6e-41 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10004224 [exp] 101 / 7e-29 AT5G06210 96 / 1e-26 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10013306 [exp] 99 / 3e-27 AT5G06210 94 / 3e-25 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10023758 [exp] 95 / 1e-25 AT2G37510 164 / 9e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003980 [exp] 92 / 3e-24 AT2G37510 169 / 1e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10034685 [exp] 92 / 2e-23 AT5G61030 177 / 7e-54 glycine-rich RNA-binding protein 3 (.1) Lus10021154 [exp] 92 / 3e-23 AT5G61030 188 / 5e-58 glycine-rich RNA-binding protein 3 (.1) Lus10017852 [exp] 91 / 4e-23 AT5G61030 178 / 7e-55 glycine-rich RNA-binding protein 3 (.1) Lus10040519 [exp] 92 / 2e-22 AT5G61030 189 / 2e-53 glycine-rich RNA-binding protein 3 (.1) Lus10015146 [exp] 85 / 6e-22 AT3G08000 145 / 5e-46 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.006G208500.2 pacid=42769591 polypeptide=Potri.006G208500.2.p locus=Potri.006G208500 ID=Potri.006G208500.2.v4.1 annot-version=v4.1 ATGGCTGCGGCACTTAGAAGAATCGCAGGAGAGAAAAGCTTTATGCTTTCAAGTATTCGTGCTAAACTTGTTGCTGCTCCAACTGCCCTTTTCATTTGGC AGCGAGGCATAACCACTAAACTCTTTGTTGGAGGCTTGTCAATTTACACCACAGAGAATGGATTATCAGAAGCATTCTCTCAATATGGTCAGGTTGTTGA AGCTAAAATTGTGATGGACCGAGCCTTGGACAGATCTAAAGGTTTTGGTTTTGTAACTTATGCATCTGAAGATGAAGCTCAGAAAGCTCTGGATGAGATG AATGGGAAGGCACTGAATGGACGAGTCATCTATGTGGATTATGCAAAGCTCAAAACTAATTTTGGTGGTGGGATACCAATTGCTAGAGGACCTCCTGAAC CAACAACATCTGAGAGTTGA
AA sequence Show only first row Show all	>Potri.006G208500.2 pacid=42769591 polypeptide=Potri.006G208500.2.p locus=Potri.006G208500 ID=Potri.006G208500.2.v4.1 annot-version=v4.1 MAAALRRIAGEKSFMLSSIRAKLVAAPTALFIWQRGITTKLFVGGLSIYTTENGLSEAFSQYGQVVEAKIVMDRALDRSKGFGFVTYASEDEAQKALDEM NGKALNGRVIYVDYAKLKTNFGGGIPIARGPPEPTTSES

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G06210			RNA binding (RRM/RBD/RNP motif...		Potri.006G208500 [exp]	0	1
AT5G07900			Mitochondrial transcription te...		Potri.004G012400 [exp]	1.00	0.7898
AT3G49645			unknown protein		Potri.017G091300 [exp]	1.41	0.7368
AT5G59950			RNA-binding (RRM/RBD/RNP motif...		Potri.016G093944 [exp]	4.24	0.7297
AT5G64200		ATSC35, At-SC35	ARABIDOPSIS THALIANA ORTHOLOG ...		Potri.003G023800 [exp]	12.44	0.6616
AT5G11870			Alkaline phytoceramidase (aPHC...		Potri.006G228700 [exp]	12.96	0.6705
AT4G24220		5[beta]-StR, 5[...	VEIN PATTERNING 1, Δ4,5-s...		Potri.017G030700 [exp]	14.38	0.7042
AT5G26800			unknown protein		Potri.005G011800 [exp]	14.56	0.7177
AT1G20823			RING/U-box superfamily protein...		Potri.007G064401 [exp]	14.69	0.6990
AT3G27340			unknown protein		Potri.001G336600 [exp]	15.16	0.6326
AT4G13720			Inosine triphosphate pyrophosp...		Potri.003G175800 [exp]	15.68	0.7125

Compare expression of checked genes

Potri.006G208500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.