Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11530 211 / 2e-72 Vacuolar protein sorting 55 (VPS55) family protein (.1), Vacuolar protein sorting 55 (VPS55) family protein (.2) AT1G32410 126 / 2e-38 Vacuolar protein sorting 55 (VPS55) family protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G146600 [exp] 134 / 1e-41 AT1G32410 176 / 6e-58 Vacuolar protein sorting 55 (VPS55) family protein Potri.003G087500 [exp] 129 / 7e-40 AT1G32410 180 / 1e-59 Vacuolar protein sorting 55 (VPS55) family protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004221 [exp] 171 / 1e-53 AT5G27720 182 / 2e-57 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10029426 [exp] 171 / 1e-51 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10006605 [exp] 125 / 4e-37 AT1G32410 202 / 4e-67 Vacuolar protein sorting 55 (VPS55) family protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04133 [poplar] [flax] Vps55 Vacuolar protein sorting 55
Representative CDS sequence Show only first row Show all	>Potri.006G209100.2 pacid=42770388 polypeptide=Potri.006G209100.2.p locus=Potri.006G209100 ID=Potri.006G209100.2.v4.1 annot-version=v4.1 ATGTTTTCGGCTAGCATTCTGCTACAGATATTGGCTTGTGCAATATACAATAATTGGTGGCCCATGCTATCAGCTCTCATGTATGTGCTGGTGCCTATGC CTTGCTTATTCTTTGGGGGTGGATCCACTCAGTTTCTGACCAGCAGGGATGGTGGGGGTTGGATAGATGCTGCTAAATTCCTGACGGGGGCGTCAGCTGT TGGGAGTATAGCCATTCCCATTATCCTTAGGCACGCTCATATGATTGAAACCGGGGCTATGTGGATTGAGTTCACATCATTTGTCATATTTGTCTGCACT GTCATGTGTTTTCACCGTGCTAGCCTAGAAGACGAGTGGTGA
AA sequence Show only first row Show all	>Potri.006G209100.2 pacid=42770388 polypeptide=Potri.006G209100.2.p locus=Potri.006G209100 ID=Potri.006G209100.2.v4.1 annot-version=v4.1 MFSASILLQILACAIYNNWWPMLSALMYVLVPMPCLFFGGGSTQFLTSRDGGGWIDAAKFLTGASAVGSIAIPIILRHAHMIETGAMWIEFTSFVIFVCT VMCFHRASLEDEW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G11530			Vacuolar protein sorting 55 (V...		Potri.006G209100 [exp]	0	1
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Potri.009G044500 [exp]	1.73	0.7857	ATPH1.1
AT3G23325			Splicing factor 3B subunit 5/R...		Potri.008G168000 [exp]	4.47	0.7824
AT2G39445			Phosphatidylinositol N-acetylg...		Potri.002G134800 [exp]	6.70	0.7343
AT4G36720		HVA22K	HVA22-like protein K (.1)		Potri.009G113400 [exp]	10.39	0.7196
AT5G19140		AtAILP1, AILP1	Aluminium induced protein with...		Potri.008G203400 [exp]	11.83	0.7179
AT4G12040		AtSAP7	stress-associated protein 7, A...		Potri.007G078500 [exp]	14.96	0.7412
AT3G48330		ATPIMT1, PIMT1	Arabidopsis thaliana protein-l...		Potri.015G086600 [exp]	19.33	0.6724
AT2G48150		ATGPX4	glutathione peroxidase 4 (.1)		Potri.014G138800 [exp]	21.79	0.6773	GPX4.1,PtrcGpx4
AT2G05630		ATG8D	Ubiquitin-like superfamily pro...		Potri.002G228800 [exp]	23.81	0.7484
AT4G13520		SMAP1	small acidic protein 1 (.1)		Potri.008G174000 [exp]	25.78	0.7317

Compare expression of checked genes

Potri.006G209100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.